Entry information : EglPrx05
Entry ID 10828
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2016-03-21 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-03-21 (Achraf Jemmat)
Peroxidase information: EglPrx05
Name EglPrx05
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx05
start..stop
S start..stop
EguPrx05 354 2e-124 1..278 1..272
EglPrx02 235 7e-77 39..278 33..309
EgrPrx[P]07 218 1e-70 38..278 44..272
EglPrx[P]07 203 1e-65 38..278 12..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..33 33 N° 2 109..246 138 N° 3 472..600 129 N° 4 1236..1371 136
N° 5 1462..1601 140  
join(1..33,109..246,472..600,1236..1371,1462..1601)


exon

Literature and cross-references EglPrx05
Protein sequence: EglPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   278 (257)
PWM (Da):   %s   21873.09 (20344.3)  
PI (pH):   %s   8.57 (8.35) Peptide Signal:   %s   cut: 22 range:22-278
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLLxxxxxxxxxxxxxxxxxxxxxxxxxQWQFYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVKxxxxxxxxxxxxxxxxxxxNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLxxxxxxxDRLYNFNKTGKPDPSVDPSFLSQLREQCPPNSTNQVYLNPDSGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSYQIAQRYDASFKDFKKMFGRSMTRLxLVKLLPGDQGEVRKNCRVVN

Retrieve as FASTA  
Remarks Partial sequence from NGS. PS and several fragments are missing due to NNNN. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTTTTGCTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GTCCGTACTGTCTGTTTCTTTTCCCCCCGCTCTCGAACGATCTTGAAGTTTGCATGGCTTCGATATCGAGCTTCCATTGCCTTTCTAAGCACGTGATATCCTTTCACCTAACGT
TTAAACCTCTCGAACCGGGCTTTCTAATGTACCGCGCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATGCAGCG
TTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GTATGCAACATGATTCGCAGTTTTCCTTTTTGAGCTTGAAAAGAGATCGTTTGGTCTGCACTGATGATAATCACTATGCTGTTAGCTTGAGTTTTTGGAGCGTTCGATATGGCAAAAGAA
AAAAAANNNNNNNNNNNNNNNNGATAATGATGTTGTAATAGGCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCAAAGTCAGTGGACTTACCGT
TGCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTGGTACGATCCGAACCTCCCATGAAAACTGCTTATTTGGCT
CCGTTACATTACCTTGAGATCGTAACCAATCCAGGCAAATCGTTCAGTTCAATGAATCATGACGTCCCTCTTCGCTTTCGAGTTTTCTAAATCGCTGCCTAGGTGTCATGATACAAAGAA
TTCTTCTGACAATGATCTCCTCCAAGTGCACAAAATGGCATTGCTCACGTATTATGTTAATCTCTCGATCATAACCAATTCCTCCTAACTTTGCCAAAACAATTTAAATTTTGACAGGGG
GGCATTCACTGGGCAAGACCNNNNNNNNNNNNNNNNNGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAAT
GCCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGA
GCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCAAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTNNNGCTCGTCAAGCTCCTTCCGG
GGGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTTTTGCTACTGCAGTGGCAGTTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGG
ACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTCGTCAAG
AATGCAGCGTTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGT
CCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
NNGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCC
TTTTTGTCCCAATTGAGGGAGCAATGCCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGA
GCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCAAGGACTTC
AAGAAGATGTTCGGCCGGTCAATGACCCGGCTNNNGCTCGTCAAGCTCCTTCCGGGGGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAAT

Retrieve as FASTA