Entry information : EglPrx[P]07
Entry ID 10830
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2014-03-26 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: EglPrx[P]07
Name EglPrx[P]07
Class Class III peroxidase     [Orthogroup: Prx092]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]07
start..stop
S start..stop
EgrPrx[P]07 400 1e-143 1..226 33..274
EguPrx05 342 2e-120 1..226 27..274
EglPrx02 276 1e-93 13..226 33..311
EcamPrx[P]07 252 1e-86 92..226 14..148
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 79..246 168 N° 2 468..571 104 N° 3 1297..1705 409  
join(79..246,468..571,1297..1705)


exon

Literature and cross-references EglPrx[P]07
Protein sequence: EglPrx[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   25328.38  
PI (pH):   %s   8.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAVGIQPPEKLQWHYYQNSCRDAERYVRNQVEFYWKLDRSLAPKLIRMxYSDCFVTGCDASILLDGPYSEKTAPQNAGLLGFPMAVIDKIKHSMGKTNCSFIADRLYNFNNTGKPDPSMDSSFLAQMRVQCPPNSKNQVYLDPDSGSSYSFSKSFYSRVLNHRAVLGIDQQIAANNDSSQIAEEYNASFEDFRKIFALSMSRMGNIKVSTGNQGEIRKNCRVVNRK

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and PS are missing due to NNNN. Stops in frame. Containing motif YSDC instead of FHDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCGGCAGTGGGGATCCAGCCACCGGAGAAGCTGCAGTGGCATTACTACCAGAACTCATGCCGCGACGCGGAGAGGTACGTGAGGAACCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGC
CTTGCTCCCAAGCTCATCCGAATGCNCTACTCCGATTGCTTTGTCACG
GTACGTATCGGCTATTTTTATCCTCTTTTGAGCAATCTTTAAGTCCGCATCGTCTCAACATCGAGTTTCCAT
CGCCCTTCCAGGTACATGATATCTTTTCACCCAATGGTTTATCCTCTCGAACTGGGCTTTCTTACATACCAATTGCCACTCTTTTGTGTACATATATAAAAAACAAAGCCTTGGACTCTC
AGATATGTTTGGTTATGTGTATAAAACAGGGGTGTGATGCGTCAATTCTGTTGGACGGGCCATATTCAGAGAAAACGGCACCACAAAATGCAGGGCTTCTAGGGTTTCCTATGGCGGTGA
TAGACAAGATCAA
GCAAGTCCTGGAACAACGTTGTCCAGGAGTCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTGGTATGGCACCTGGTTTGCACTTCTC
TCTCTTTTGGCTTGAAAATGAGTTGTTTTCGCTGCACTGATTATTGACATGCTGTTAGCTTGAGCTTGGAGCGTTAAATTTGGAAAATTAGAATCACTGATGCGATACTATGTTGTAATA
GGCAGGAGGGCCATCGTACCCCGTTCTGGCGGGGAGGAAGGATGGGATGTCGTCCTCCGCAGCGTTGGTGGACCTACCGTTGGGGGCTGTCCCTTGGGGATCAGCTCTCGCGTACTTCGA
ATCAAGGGGCTTGGATGTGCTGGACCTTACTACTCTACTTGGTACAATCCAACCTCATATGCAAAGTATTTATTTGACTTGGACCTCATTAAATTACCTTAGATCTTAAGTAATCCGGGC
AATTTGTTTAATTTAGTGCGGTTGCGAGGAAAAAGAAATCACGATGTTACTTTTCGATTTTAAGTTTTCAAAATCTCCGTCTAATTTTCAGGATACAAAGAATTTTATCAGATATAGGAT
AGTCGAGGATATAATCCAAACCGATCCTCCCAATGATTACCTCCATGTGCACAAAATGATATGCTTATGTATTATGTCAACTCTCAAAGTCAGAACCATTTCCTAACTTGCCAAAACAAT
TTAAATTTTGCCNGGGGGGCATTCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACAGGCTGTACAATTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACTCATCTTTCTTGGC
CCAGATGAGGGTGCAATGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGT
CCTCGGCATCGACCAGCAGATTGCCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAATGCCAGTTTCGAGGACTTCCGGAAGATTTTCGCCTTGTCAATGAGCCGGATGGGGAA
CATCAAGGTCTCAACGGGGAATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCGGCAGTGGGGATCCAGCCACCGGAGAAGCTGCAGTGGCATTACTACCAGAACTCATGCCGCGACGCGGAGAGGTACGTGAGGAACCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGC
CTTGCTCCCAAGCTCATCCGAATGCNCTACTCCGATTGCTTTGTCACG
GGGTGTGATGCGTCAATTCTGTTGGACGGGCCATATTCAGAGAAAACGGCACCACAAAATGCAGGGCTTCTA
GGGTTTCCTATGGCGGTGATAGACAAGATCAA
GCATTCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACAGGCTGTACAATTTCAACAACACTGGCAAGCCAGACCCAAGCATGGAC
TCATCTTTCTTGGCCCAGATGAGGGTGCAATGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTG
AACCACCGGGCCGTCCTCGGCATCGACCAGCAGATTGCCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAATGCCAGTTTCGAGGACTTCCGGAAGATTTTCGCCTTGTCAATG
AGCCGGATGGGGAACATCAAGGTCTCAACGGGGAATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA