Entry information : EglPrx09
Entry ID 10832
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2014-03-24 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-24 (Christophe Dunand)
Peroxidase information: EglPrx09
Name EglPrx09
Class Class III peroxidase    [Orthogroup: Prx119]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx09
start..stop
S start..stop
EgrPrx09 615 0 1..335 1..334
EcamPrx09 603 0 1..335 1..333
EgrPrx08 548 0 1..335 1..337
EglPrx08 541 0 1..335 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..246 246 N° 2 465..653 189 N° 3 800..959 160 N° 4 1293..1705 413
join(1..246,465..653,800..959,1293..1705)


exon

Literature and cross-references EglPrx09
Protein sequence: EglPrx09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (308)
PWM (Da):   %s   36817.35 (33732.7)  
PI (pH):   %s   8.46 (7.69) Peptide Signal:   %s   cut: 28 range:28-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWRLLLLAVLALMSSCAMRRVEAAVGIQPPEKLQWHYYQNSCRDAERYVRNQVEFYWKLDRSLAPKLIRMxYSDCFVTQGCDASILLDGPYSEKTAPQNAGLLGFPMAVIDKIKQVLEQRCPGVVSCADILNFAARDAAHLAGGPSYPVLAGRKDGMSSSAALVDLPLGAVPWGSALAYFESRGLDVLDLTTLLGGHSMGKTNCSFIADRLYNFNNTGKPDPSMDSSFLAQMRVQCPPNSKNQVYLDPDSGSSYSFSKSFYSRVLNHRAVLGIDQQIAANNDSSQIAEEYNASFEDFRKIFALSMSRMGNIKVSTGNQGEIRKNCRVVNRK

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns). Containing motif YSDC instead of FHDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGCGGTTGTTGTTGCTGGCGGTGCTCGCATTGATGAGCTCATGCGCCATGCGGCGTGTCGAGGCGGCAGTGGGGATCCAGCCACCGGAGAAGCTGCAGTGGCAT
TACTACCAGAACTCATGCCGCGACGCGGAGAGGTACGTGAGGAACCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTTGCTCCCAAGCTCATCCGAATGCNCTACTCCGATTGCTTT
GTCACG
GTACGTATCGGCTATTTTTATCCTCTTTTGAGCAATCTTTAAGTCCGCATCGTCTCAACATCGAGTTTCCATCGCCCTTCCAGGTACATGATATCTTTTCACCCAATGGTTTAT
CCTCTCGAACTGGGCTTTCTTACATACCAATTGCCACTCTTTTGTGTACATATATAAAAAACAAAGCCTTGGACTCTCAGATATGTTTGGTTATGTGTATAAAACAGGGGTGTGATGCGT
CAATTCTGTTGGACGGGCCATATTCAGAGAAAACGGCACCACAAAATGCAGGGCTTCTAGGGTTTCCTATGGCGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCAGGAG
TCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GTATGGCACCTGGTTTGCACTTCTCTCTCTTTTGGCTTGAAAATGAGTTGTTTTCGCTGCACTGATT
ATTGACATGCTGTTAGCTTGAGCTTGGAGCGTTAAATTTGGAAAATTAGAATCACTGATGCGATACTATGTTGTAATAGGCAGGAGGGCCATCGTACCCCGTTCTGGCGGGGAGGAAGGA
TGGGATGTCGTCCTCCGCAGCGTTGGTGGACCTACCGTTGGGGGCTGTCCCTTGGGGATCAGCTCTCGCGTACTTCGAATCAAGGGGCTTGGATGTGCTGGACCTTACTACTCTACTTG
G
TACAATCCAACCTCATATGCAAAGTATTTATTTGACTTGGACCTCATTAAATTACCTTAGATCTTAAGTAATCCGGGCAATTTGTTTAATTTAGTGCGGTTGCGAGGAAAAAGAAATCAC
GATGTTACTTTTCGATTTTAAGTTTTCAAAATCTCCGTCTAATTTTCAGGATACAAAGAATTTTATCAGATATAGGATAGTCGAGGATATAATCCAAACCGATCCTCCCAATGATTACCT
CCATGTGCACAAAATGATATGCTTATGTATTATGTCAACTCTCAAAGTCAGAACCATTTCCTAACTTGCCAAAACAATTTAAATTTTGCCNGGGGGGCATTCAATGGGCAAGACCAACTG
CAGCTTCATCGCGGACAGGCTGTACAATTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACTCATCTTTCTTGGCCCAGATGAGGGTGCAATGCCCACCGAACTCAAAGAATCAAGT
GTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCGGCATCGACCAGCAGATTGCCGCCAACAACGACAGCTC
CCAGATCGCTGAGGAGTACAATGCCAGTTTCGAGGACTTCCGGAAGATTTTCGCCTTGTCAATGAGCCGGATGGGGAACATCAAGGTCTCAACGGGGAATCAGGGGGAGATTCGCAAGAA
TTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGCGGTTGTTGTTGCTGGCGGTGCTCGCATTGATGAGCTCATGCGCCATGCGGCGTGTCGAGGCGGCAGTGGGGATCCAGCCACCGGAGAAGCTGCAGTGGCAT
TACTACCAGAACTCATGCCGCGACGCGGAGAGGTACGTGAGGAACCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTTGCTCCCAAGCTCATCCGAATGCNCTACTCCGATTGCTTT
GTCACG
CAGGGGTGTGATGCGTCAATTCTGTTGGACGGGCCATATTCAGAGAAAACGGCACCACAAAATGCAGGGCTTCTAGGGTTTCCTATGGCGGTGATAGACAAGATCAAGCAAGTC
CTGGAACAACGTTGTCCAGGAGTCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GCAGGAGGGCCATCGTACCCCGTTCTGGCGGGGAGGAAGGATGGG
ATGTCGTCCTCCGCAGCGTTGGTGGACCTACCGTTGGGGGCTGTCCCTTGGGGATCAGCTCTCGCGTACTTCGAATCAAGGGGCTTGGATGTGCTGGACCTTACTACTCTACTTG
GGGGG
CATTCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACAGGCTGTACAATTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACTCATCTTTCTTGGCCCAGATGAGGGTGCAATGC
CCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCGGCATCGACCAGCAG
ATTGCCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAATGCCAGTTTCGAGGACTTCCGGAAGATTTTCGCCTTGTCAATGAGCCGGATGGGGAACATCAAGGTCTCAACGGGG
AATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA