Entry information : EglPrx13
Entry ID 10836
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: EglPrx13
Name EglPrx13
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx13
start..stop
S start..stop
EgrPrx13 615 0 1..313 1..334
EgrPrx04 590 0 1..313 1..334
EguPrx04 589 0 1..313 1..334
EcamPrx04 579 0 5..313 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..246 246 N° 2 446..631 186 N° 3 765..924 160 N° 4 1219..1424 206
N° 5 1461..1538 78 N° 6 1566..1631 66  
join(1..246,446..631,765..924,1219..1424,1461..1538,1566..1631)


exon

Literature and cross-references EglPrx13
Protein sequence: EglPrx13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (294)
PWM (Da):   %s   34055.15 (31881.0)  
PI (pH):   %s   5.42 (5.20) Peptide Signal:   %s   cut: 20 range:20-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSTLALVSSCAxxxVEAEATIELPPPLQWHFYQNSCPDVERYVRDQVEFYWKQDSTLAVKLIQLLYTDCFIKGCDASILLDGPDTEKTAPQNAPILGFPLEAIDKVKEVLEQHCPGVVSCADIINLAARDAVVLAGGVSYPVPTGRRDGNSSSAKLVDIAVHATPWEKVIHYFEVRGMNVFDVTTLLGGHTLGRTRCKFIAERLYDFNNTGKPDxxxxxSFLAELRVQCPPNSTNSVYLNPDSGSSNRFGKTFYSRxIADREESLQIARRYDANFEDFLKMFTWLLPGDQGEIRKNCRVVNRK

Retrieve as FASTA  
Remarks Partial sequence from NGS. PS are missing due to NNNN. containing motif YTDC. No EST found.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTGTTGCTATCGACGCTCGCGTTGGTGAGCTCGTGCGCGGNNNNNNNCGTTGAGGCCGAGGCGACGATCGAGCTGCCGCCGCCGCTGCAGTGGCAT
TTCTACCAGAACTCATGCCCCGACGTCGAGAGGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCCGTCAAGCTCATCCAACTTCTCTACACTGACTGCTTC
ATCAAG
GTACGTACCGTCTGCTCATTTCCCTCTCTCTCTCTCTCTCTCAAACGATCTCAAAGTCAGCATCGCTTCGATCATCGAGTTTCTGTCGCCCCTTCTGAGCATGCCATATACTTT
CACCCAATGGTTTAACCTCTCGGACTCGTCTTTCTAGCATACCAATCTTTTCTNNNNNNNNNNNNNNNNNNNNNGGATAAAAAAGGGATGCGATGCGTCGATTCTCTTGGACGGGCCAGA
CACAGAGAAAACAGCACCACAAAATGCACCGATCCTAGGTTTTCCTCTTGAGGCGATTGACAAGGTCAAGGAAGTTCTGGAACAGCACTGTCCCGGGGTCGTCTCTTGCGCCGACATTAT
CAACCTTGCCGCTAGAGACGCTGTCGTCTTG
GTATGCAACATGGTTCTCAGTTTTTCCTTTTTGGGCTGGAAAAGAGATATGCTGTTAGCTTGAGTTTTGGAGCGTTCGATATGGACAGA
AAAAAAAAATCAGAATTACTGATGTGATAATGATGTTGTAATAGGCGGGAGGAGTGTCGTACCCCGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAGTGCGAAGTTGGTGGACATCG
CAGTGCACGCCACCCCGTGGGAAAAGGTGATCCATTACTTCGAAGTAAGGGGCATGAATGTGTTCGACGTCACTACTCTACTTG
GTACGGTCTAACTCTCGAATGAAAAGTGTTTATTTG
ACTCCGACCTCATTACATTACCTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCAAGCTGTCCATTTAGCTTTCGCTAAGTCGAAGAATTTTATCAGATATAGAATT
GTCGAGGATGTAATCCGAAGCAATCCTCATAATGATCTCCTCCAAGTGCACAAAAATGGCATGCTCACGTAATATATCAATCTCTCAATCATAACCAATTCCTCCTTACTTTGCCAAAAA
CAATTTAAATTTTGCCAGGGGGCCATACACTGGGCAGGACCAGATGCAAGTTCATCGCAGAAAGACTGTATGATTTCAACAACACTGGCAAGCCAGACCNNNNNNNNNNNNNATCCTTCT
TGGCCGAATTGAGGGTGCAATGCCCGCCCAACTCAACGAATTCAGTGTACCTTAACCCTGACTCAGGCTCGAGTAACAGGTTCGGCAAAACCTTCTACTCCAGG
GTNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNATCGCCGACCGTGAGGAGAGCCTCCAGATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGNNNNNNNNNNNNNNNNNNNNN
NNNACACCTGGCTCCTGCCAGGGGATCAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTGTTGCTATCGACGCTCGCGTTGGTGAGCTCGTGCGCGGNNNNNNNCGTTGAGGCCGAGGCGACGATCGAGCTGCCGCCGCCGCTGCAGTGGCAT
TTCTACCAGAACTCATGCCCCGACGTCGAGAGGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCCGTCAAGCTCATCCAACTTCTCTACACTGACTGCTTC
ATCAAG
GGATGCGATGCGTCGATTCTCTTGGACGGGCCAGACACAGAGAAAACAGCACCACAAAATGCACCGATCCTAGGTTTTCCTCTTGAGGCGATTGACAAGGTCAAGGAAGTTCTG
GAACAGCACTGTCCCGGGGTCGTCTCTTGCGCCGACATTATCAACCTTGCCGCTAGAGACGCTGTCGTCTTG
GCGGGAGGAGTGTCGTACCCCGTTCCGACGGGGAGGAGGGACGGAAAT
TCGTCCAGTGCGAAGTTGGTGGACATCGCAGTGCACGCCACCCCGTGGGAAAAGGTGATCCATTACTTCGAAGTAAGGGGCATGAATGTGTTCGACGTCACTACTCTACTTG
GGGGCCAT
ACACTGGGCAGGACCAGATGCAAGTTCATCGCAGAAAGACTGTATGATTTCAACAACACTGGCAAGCCAGACCNNNNNNNNNNNNNATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCG
CCCAACTCAACGAATTCAGTGTACCTTAACCCTGACTCAGGCTCGAGTAACAGGTTCGGCAAAACCTTCTACTCCAGG
NNNATCGCCGACCGTGAGGAGAGCCTCCAGATTGCCCGGCGG
TACGATGCCAATTTTGAGGACTTCCTGAAGATGTTC
ACCTGGCTCCTGCCAGGGGATCAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAATAA

Retrieve as FASTA