Entry information : EglPrx15
Entry ID 10838
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2015-12-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-15 (Achraf Jemmat)
Peroxidase information: EglPrx15
Name EglPrx15
Class Class III peroxidase    [Orthogroup: Prx056]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx15
start..stop
S start..stop
EgrPrx15 646 0 1..333 1..333
EcamPrx15 641 0 1..333 1..333
EgrPrx02 634 0 5..333 1..329
EguPrx02 633 0 5..333 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..246 246 N° 2 441..626 186 N° 3 789..948 160 N° 4 1204..1610 407
join(1..246,441..626,789..948,1204..1610)


exon

Literature and cross-references EglPrx15
Protein sequence: EglPrx15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333
PWM (Da):   %s   35631.12  
PI (pH):   %s   7.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSAxxLLRSCEAHPIEAKATIKLPPPLQWHFYQNSCPDVEKYVRDQVEFYWKQDSTLAPKLIQLLYTDCFIKGCDASVLLDGPDAEKTAPQNAAILGFPLEVIDKVKEVLEQHCPGVVSCADIINLAARDAVILAGGVSYPVPTGRRDGNSSNAKLVDLPKRAVPWEKVIPYFKIRGLDLFDVTTLLGGHTLGRTxxxxxxERLYEFNNTGKPDPSMDPSFLAELRVQCPPNSTNSVYLNPDSGSSNRFSKTFYSRVLNHRAVLSIDQQIAAHKESxxxxxxYDANFEDFLKMFGYSMTKLGNTWLLPGDQGEIRKNCRVVNG

Retrieve as FASTA  
Remarks Complete sequence from NGS. containing motif ytdc
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTGTTGCTATCGGCGCNNNNNTTGTTGCGCTCGTGCGAGGCACACCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCAT
TTCTACCAGAACTCGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTC
ATCAAG
GCACGTACCGTCTGTTCATTTCCTTCTTTCTGTCTCTCTCGCGATCTTGAAGTCGGCATCACTTTAATCATCGAGTTTCCGTTGCCCTATCTAAGCATGCCAAATCCTTTCACC
CGTTGGTTTAACTTCTCGAACTGGGCTTTCTAATATACCACTCTTCTGTGTACGTATGTATGGTTATGTGGATAAAACAGGGATGCGATGCGTCGGTTCTCTTGGACGGGCCAGATGCAG
AGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCGGGGTCGTCTCTTGCGCCGACATTATCAACC
TTGCCGCTAGAGATGCTGTCATTTTG
GTATGCAGCATGGTTCTGAGTTTTTCCTTTTTGAGCTGGAAAAGAGATTGTTTGGGCTGCTGCACTGATGATAATCGACGTGCTGTTAGCTTGA
GTTTTGGAGCGTTCGATATGGAAAGGAAAAAAATTAGAATTACTAATGTGATAATGATGTTGTAATAGGCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGT
CCAATGCGAAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GTACGGTCTAAC
CCTCGAATGAAAAGTGTTTATTTGACTCCGACCTCGTTACATTACCTTAAGATCTTAACCAATCCAGGCAACTCATTTAGTTCAGTGAATCACGCTGTCCCTTCTAGCTTTCATGTGATC
CGAACCAATCCTCCCAATGATCTCCTCCAAGTGCACAAAAATGGCATGCTCACGTATCATGTCGAACTCTCAATCATAACCAATTCCTCCTAACTTTTCCAAAAACAACTTAAATTTTGC
CAGGGGGGCATACACTGGGCAGGACNNNNNNNNNNNNNNNNNNAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGG
TGCAATGCCCGCCAAACTCAACGAATTCAGTGTACCTAAATCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCG
ACCAGCAGATCGCCGCCCATAAGGAGAGCCNNNNNNNNNNNNNNNNNTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTGTTGCTATCGGCGCNNNNNTTGTTGCGCTCGTGCGAGGCACACCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCAT
TTCTACCAGAACTCGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTC
ATCAAG
GGATGCGATGCGTCGGTTCTCTTGGACGGGCCAGATGCAGAGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTG
GAACAGCATTGTCCCGGGGTCGTCTCTTGCGCCGACATTATCAACCTTGCCGCTAGAGATGCTGTCATTTTG
GCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAAT
TCGTCCAATGCGAAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GGGGGCAT
ACACTGGGCAGGACNNNNNNNNNNNNNNNNNNAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCG
CCAAACTCAACGAATTCAGTGTACCTAAATCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATC
GCCGCCCATAAGGAGAGCCNNNNNNNNNNNNNNNNNTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCA

Retrieve as FASTA