Entry information : EglPrx16
Entry ID 10839
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2014-03-26 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: EglPrx16
Name EglPrx16
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx16
start..stop
S start..stop
EgrPrx16 697 0 1..337 1..337
EcamPrx01 693 0 1..337 1..337
EguPrx01 691 0 1..337 1..337
EcamPrx16 691 0 1..337 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..243 243 N° 2 413..598 186 N° 3 746..905 160 N° 4 1022..1446 425
join(1..243,413..598,746..905,1022..1446)


exon

Literature and cross-references EglPrx16
Protein sequence: EglPrx16
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337
PWM (Da):   %s   37044.31  
PI (pH):   %s   5.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRWGLLLLLSELALVSLCAVQHVEAAEGLExPLTLKWHYYRNSCRDAETYVRHQVEYYWKPDKSLTPKLLRLLYSDCFITGCDASILLDGQNSEKTAPQNSGLEGYGTVVIDKIKQVLEQRCPGVVSCADILNLAARDAAHLAGAPSYPVLTGRRDGMSSSKASVDLPSPSISWEEALAYFESRNLDVLDLATLLGAHSMGKTHCSYITDRLYNYNSTGKPDPDMDPSYLAQMRKQCPPNSKSQGDPQVFLDPASGSSYTFSNSYYSRLLNHQATLGIDQQLARGDDTSQIAQEYDAGLEDFRKEFALSMARMGNIKVLTGNQGEIRKNCRAVNSK

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns). Containing motif YSDC instead of FHDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCNNCCGCTGACACTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCTAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCATC
ACG
GTACATATCGTCTGTTGTCATCGCTTTCATACCGAGTTTCAGTAGGCTTTCTGAGCTCTCTAACATATAACAATGGTGGAAACCGGGCATGTACGAGCAATAACTTGTTTTTTTCCT
TTAAAAAACAAAGGCTTGTATTGAGATACGTTTGGCTACCTGTGTAAAACAGGGGTGTGATGCGTCTATTCTGTTGGACGGGCAAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCT
TGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GT
ATGTGCCTGGTTTGCAGTTCTCTTCTTTGGCTTCAAAAGAGATTATTTTCACTGCCCTACCGATCATTGAAATGCTGCTAGCTTGAACTTGTAGTATTAGATGTGAAAAACCAGAATCGC
TGACACGATAATGTTTTTCTCACAGGCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCGTCGTCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTG
GGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GTAAGATGGATCATTGTATAAAAAAGTAAATAATTGATTTGGACCTCATCAAGTC
ATCGCTTTTTGAAACATTAAAATCAATTCCTAACTTTGCGCAAAAATATGAAATTGGACAGGGGCTCATTCAATGGGCAAGACTCACTGCAGCTATATCACAGACAGGCTGTACAATTAC
AACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCAAACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCA
GGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGACCAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTAT
GATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGC
AAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCNNCCGCTGACACTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCTAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCATC
ACG
GGGTGTGATGCGTCTATTCTGTTGGACGGGCAAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAA
CAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCG
TCGTCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GGGCTCATTCA
ATGGGCAAGACTCACTGCAGCTATATCACAGACAGGCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCA
AACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGAC
CAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGCAAATAA

Retrieve as FASTA