Entry information : OsPrx75
Entry ID 1085
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx75
Name OsPrx75
Class Class III peroxidase    [Orthogroup: Prx151]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx75
start..stop
S start..stop
SbPrx127 523 0 10..349 11..347
SiPrx90 518 0 36..349 34..336
ZmPrx102 513 0 28..349 23..340
BdiPrx70 494 2e-177 37..349 36..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24442227..24442472 246 N° 2 24442549..24442734 186 N° 3 24442818..24442983 166 N° 4 24443109..24443560 452
join(24442227..24442472,24442549..24442734,24442818..24442983,24443109..24443560 )


exon

Literature and cross-references OsPrx75
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6AUW9
DNA ref. GenBank:   NC_008398.1 (24442227..24443557)
Protein sequence: OsPrx75
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (331)
PWM (Da):   %s   37353.31 (35340.2)  
PI (pH):   %s   5.57 (5.56) Peptide Signal:   %s   cut: 19 range:19-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRELELLLFLLALRASGEVVAGSAEAAAAAAAWPALQVGFYHAKCPVAEDVVLGEMRMILEEDPTLAPSLLRMHYHDCFVQGCDGSIMLRSRSGKGERDATPNRSMRGYDAINRIKARLETVCPLTVSCADIIAMAARDAVYLSKGPWYDVETGRRDGDVSVAEYAENDLAPPDSNIVDVKTFFSVKSLNAKDIAVLFGCHSIGTSHCGAFQKRLYNFTGRMDQDPSLDAGYAAKLKKLCPPGHGHDHDHDGHGGAGGAAKVPMDPGSGFTFDLSYYRHVLATGGLFQSDGSLRDDPVTRGYVEKLANASSSEEYFADFAAAMVKMGRTDVLTGDLGAVRPTCDSLVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCGGGAGCTGGAGCTGCTGCTGTTTTTGCTGGCCCTACGGGCGAGCGGCGAGGTCGTCGCGGGTTCGGCGGAGGCAGCGGCAGCGGCAGCGGCGTGGCCCGCGCTGCAGGTGGGG
TTCTACCATGCCAAGTGCCCTGTCGCGGAGGACGTCGTGCTGGGCGAGATGAGGATGATCCTCGAGGAGGATCCCACGCTCGCGCCGTCTCTGCTCCGGATGCACTACCACGACTGCTTC
GTCCAG
GTAATTAACAATTTTTAATTGCCCCAAGCTACTTCATGCTCGTCCATGGCGATCATCGTGGTTGGGTTGGTTGCAGGGGTGTGACGGATCGATCATGCTGAGGTCGAGGAGCGG
GAAGGGGGAGAGGGACGCGACGCCCAACCGGAGCATGCGGGGCTACGACGCCATCAATCGGATCAAGGCGAGGCTGGAGACCGTCTGCCCGCTCACCGTCTCCTGCGCCGACATCATCGC
CATGGCGGCGAGAGACGCCGTCTACCTG
GTACGCGCCTCACGGAACAAATCCATGGCTTCTTTGCAAATCGATATCGCGCTCTGCTTCTGAATGCTCCTTGATTCGCACAGAGCAAGGGG
CCGTGGTACGACGTGGAGACCGGGAGGAGGGACGGCGACGTGAGCGTGGCCGAGTACGCCGAGAACGACCTGGCGCCGCCGGACTCCAACATCGTCGACGTCAAGACCTTCTTCAGCGTC
AAGTCTCTCAACGCCAAGGACATCGCCGTGCTCTTCG
GTACGTATACTACCACGCCGTCTCCTTTTCCCCTTTTGCTTCTCGCGTTGGACGACGGCGACAGCTTATCAGAACGCCGGTAA
TGGCCATTGGCCGCCGCCGGCGGCGGCGGCGGCGTCGTGCAGGATGCCACAGCATCGGGACGTCGCACTGCGGGGCGTTCCAGAAGCGGCTGTACAACTTCACCGGAAGGATGGACCAGG
ACCCGTCGCTGGACGCCGGCTACGCGGCGAAGCTCAAGAAGCTCTGCCCGCCGGGGCACGGCCACGACCACGACCACGACGGCCATGGCGGCGCCGGCGGCGCGGCCAAGGTGCCCATGG
ACCCCGGCAGCGGCTTCACATTCGACCTGAGCTACTACCGGCACGTGCTCGCCACGGGCGGCCTGTTCCAGTCGGACGGCAGCCTCCGCGACGACCCCGTCACGAGGGGCTACGTCGAGA
AGCTCGCCAACGCGTCGTCGTCGGAGGAGTACTTCGCCGACTTCGCGGCGGCGATGGTCAAGATGGGCCGCACCGACGTGCTCACCGGCGATCTCGGGGCGGTCAGGCCGACGTGTGACA
GCCTCGTCGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCGGGAGCTGGAGCTGCTGCTGTTTTTGCTGGCCCTACGGGCGAGCGGCGAGGTCGTCGCGGGTTCGGCGGAGGCAGCGGCAGCGGCAGCGGCGTGGCCCGCGCTGCAGGTGGGG
TTCTACCATGCCAAGTGCCCTGTCGCGGAGGACGTCGTGCTGGGCGAGATGAGGATGATCCTCGAGGAGGATCCCACGCTCGCGCCGTCTCTGCTCCGGATGCACTACCACGACTGCTTC
GTCCAG
GGGTGTGACGGATCGATCATGCTGAGGTCGAGGAGCGGGAAGGGGGAGAGGGACGCGACGCCCAACCGGAGCATGCGGGGCTACGACGCCATCAATCGGATCAAGGCGAGGCTG
GAGACCGTCTGCCCGCTCACCGTCTCCTGCGCCGACATCATCGCCATGGCGGCGAGAGACGCCGTCTACCTG
AGCAAGGGGCCGTGGTACGACGTGGAGACCGGGAGGAGGGACGGCGAC
GTGAGCGTGGCCGAGTACGCCGAGAACGACCTGGCGCCGCCGGACTCCAACATCGTCGACGTCAAGACCTTCTTCAGCGTCAAGTCTCTCAACGCCAAGGACATCGCCGTGCTCTTCG
GA
TGCCACAGCATCGGGACGTCGCACTGCGGGGCGTTCCAGAAGCGGCTGTACAACTTCACCGGAAGGATGGACCAGGACCCGTCGCTGGACGCCGGCTACGCGGCGAAGCTCAAGAAGCTC
TGCCCGCCGGGGCACGGCCACGACCACGACCACGACGGCCATGGCGGCGCCGGCGGCGCGGCCAAGGTGCCCATGGACCCCGGCAGCGGCTTCACATTCGACCTGAGCTACTACCGGCAC
GTGCTCGCCACGGGCGGCCTGTTCCAGTCGGACGGCAGCCTCCGCGACGACCCCGTCACGAGGGGCTACGTCGAGAAGCTCGCCAACGCGTCGTCGTCGGAGGAGTACTTCGCCGACTTC
GCGGCGGCGATGGTCAAGATGGGCCGCACCGACGTGCTCACCGGCGATCTCGGGGCGGTCAGGCCGACGTGTGACAGCCTCGTCGACTAG

Retrieve as FASTA