Entry information : EglPrx[P]34
Entry ID 10857
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EglPrx[P]34
Name EglPrx[P]34
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]34
start..stop
S start..stop
EguPrx[P]34 81 1e-22 1..45 43..98
EgrPrx[P]34 81 1e-22 1..39 79..117
EguPrx[P]40 62 0.000000000000005 1..35 87..121
EcamPrx38 61 0.000000000000007 1..39 59..97
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..108 108 N° 2 142..171 30  
join(1..108,142..171)


exon

Literature and cross-references EglPrx[P]34
Protein sequence: EglPrx[P]34
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   45
PWM (Da):   %s   4886.52  
PI (pH):   %s   8.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PTIDSEMLTLHNNNSARGFKVIGQIKAEANGVCRCPLMTLLLRYV*

Retrieve as FASTA  
Remarks Pseudogene from NGS. Just short PS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGACCATCGACAGTGAAATGCTTACGCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATCGGCCAAATTAAGGCGGAGGCCAACGGAGTATGTAGATGTCCGNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNTCTCATGACTCTGTTGTTGCGGTACGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGACCATCGACAGTGAAATGCTTACGCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATCGGCCAAATTAAGGCGGAGGCCAACGGAGTATGTAGATGTCCGCTCATGACTCTG
TTGTTGCGGTACGTCTAG

Retrieve as FASTA