Entry information : EglPrx36
Entry ID 10859
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2016-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-17 (Achraf Jemmat)
Peroxidase information: EglPrx36
Name EglPrx36
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx36
start..stop
S start..stop
EgrPrx36 551 0 1..323 1..323
EgrPrx39 543 0 1..323 1..323
EgrPrx33 541 0 1..323 1..323
EguPrx39 540 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..228 228 N° 2 327..515 189 N° 3 701..1255 555  
join(1..228,327..515,701..1255)


exon

Literature and cross-references EglPrx36
Protein sequence: EglPrx36
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   30399.07 (28020.8)  
PI (pH):   %s   6.13 (6.13) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALNSLSLVQALLFLSLATSAFSTRPYKEGLTPYFYDYVCPQALPAIKRVVEAAVQQERRMGASLFRLHFHDCFVNGCDASILLDPTPTIDSEKFANPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVFQLGGPSWEVQLGRRDSTTASRTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFRNRTYNDDNIATSFARSLRSLCPRTGEDxNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQALYSGGSTDELVKTYSDDAEAFWDDFAKSMIKMGNIKPWxGNQGQIRSNCRRLN

Retrieve as FASTA  
Remarks Partial sequence from NGS. PS and part of exon3 are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAATAGCCTCAGCCTCGTCCAAGCACTTCTCTTCTTGTCTCTCGCGACCTCGGCTTTCTCGACGCGGCCCTACAAGGAAGGCCTCACGCCATACTTCTACGACTACGTTTGT
CCTCAAGCCTTGCCCGCCATCAAACGCGTTGTCGAGGCAGCGGTGCAACAGGAGCGACGCATGGGCGCTTCGTTATTCCGTTTGCACTTCCACGATTGTTTCGTTAAC
GTACGACACATT
CACGATAGTCTTGATTCGCATTGGTTATCTAGCAGCCGGCATAAATTTGCTAACTTGATTCTTGTTTTATCCACGTCATAATGTAGGGTTGCGATGCTTCAATACTTTTGGATCCGACCC
CTACCATTGACAGCGAAAAGTTCGCGAACCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGCGGATACTCACTTGTATCATGTG
CCGACATCTTGGCCGTCGCAGCCCGTGACTCGGTA
GNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNGCTAATTGAACACGCTAGGCGTAGAATCATATGCACATACATAATCTTTCGATTATCTAAGCAAAGCTGAATTTGAACTTAAAAGGTTGACTGAAATATTTCAGCTGGGAGGGCCTTC
ATGGGAAGTACAACTTGGAAGGAGGGACTCGACCACGGCGAGCAGGACAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCAGAAACCGCACATACAACGACGACAACATCGCCACCAGTTTTGCCAGGAG
CCTCCGGTCTTTGTGCCCGCGTACTGGAGAGGACNNNAACCTCGCTGGTTTGGATCCTTCGCCGGCTCAATTCGATGCATTGTACTTCCATAATCTGCTGGCGCAGAAGGGGCTTCTTCA
CTCTGATCAGGCGCTTTACAGTGGTGGGTCAACGGATGAGCTGGTGAAAACTTACAGTGATGATGCGGAGGCCTTTTGGGATGATTTTGCAAAGTCGATGATCAAGATGGGAAACATAAA
GCCGTGGANCGGAAACCAGGGCCAGATTCGCTCAAATTGCCGAAGGTTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAATAGCCTCAGCCTCGTCCAAGCACTTCTCTTCTTGTCTCTCGCGACCTCGGCTTTCTCGACGCGGCCCTACAAGGAAGGCCTCACGCCATACTTCTACGACTACGTTTGT
CCTCAAGCCTTGCCCGCCATCAAACGCGTTGTCGAGGCAGCGGTGCAACAGGAGCGACGCATGGGCGCTTCGTTATTCCGTTTGCACTTCCACGATTGTTTCGTTAAC
GGTTGCGATGCT
TCAATACTTTTGGATCCGACCCCTACCATTGACAGCGAAAAGTTCGCGAACCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGC
GGATACTCACTTGTATCATGTGCCGACATCTTGGCCGTCGCAGCCCGTGACTCGGTA
TTTCAGCTGGGAGGGCCTTCATGGGAAGTACAACTTGGAAGGAGGGACTCGACCACGGCGAGC
AGGACAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTTTCAGAAACCGCACATACAACGACGACAACATCGCCACCAGTTTTGCCAGGAGCCTCCGGTCTTTGTGCCCGCGTACTGGAGAGGACNNNAACCTC
GCTGGTTTGGATCCTTCGCCGGCTCAATTCGATGCATTGTACTTCCATAATCTGCTGGCGCAGAAGGGGCTTCTTCACTCTGATCAGGCGCTTTACAGTGGTGGGTCAACGGATGAGCTG
GTGAAAACTTACAGTGATGATGCGGAGGCCTTTTGGGATGATTTTGCAAAGTCGATGATCAAGATGGGAAACATAAAGCCGTGGANCGGAAACCAGGGCCAGATTCGCTCAAATTGCCGA
AGGTTGAACTGA

Retrieve as FASTA