Entry information : EglPrx38
Entry ID 10860
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EglPrx38
Name EglPrx38
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx38
start..stop
S start..stop
EgrPrx38 491 4e-178 1..259 1..317
EguPrx38 488 1e-176 1..259 1..317
EguPrx41 487 1e-176 1..259 1..317
EgrPrx41 486 6e-176 1..259 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..114 114 N° 2 335..535 201 N° 3 674..826 153 N° 4 875..1090 216
N° 5 1115..1207 93  
join(1..114,335..535,674..826,875..1090,1115..1207)


exon

Literature and cross-references EglPrx38
Protein sequence: EglPrx38
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   259 (238)
PWM (Da):   %s   28038.24 (25833.0)  
PI (pH):   %s   8.95 (8.95) Peptide Signal:   %s   cut: 22 range:22-259
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFLTLFQALLILSLAASTLSTRPYKNGLTPYFYDYVCMQGCDGSILLDSTATIESEKFAAPNNNSARGFEVIDQIKAEVDRVCGRPVVSCADILAITARDSVVALGGPSWKVQLGRRDSTTASRTTANNDIPAPNMDLPALINNFKRQGLKVKDLxRNRTFNDSNINQAFAKNLRSYCPRTGSDSNLASLDPTPARFDTLYYNNLLTQKGLLHSDQALSTGESALELxAFWKDFAKSMVRMGNIKPLTGNQGQIRSNC

Retrieve as FASTA  
Remarks Partial sequence from NGS. PSs are missing due to NNNN. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCCTCACCCTCTTCCAAGCGCTTCTCATCTTGTCCCTCGCGGCCTCAACTCTTTCAACTCGTCCTTACAAGAATGGCCTCACGCCATACTTCTATGACTACGTTTGCNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGCCAG
CTAACTTTCACATTAATCTGCTCTCAAAAATAGTGATTACTATTCAGCGTAACACAAGATTTGCCAACATTGATTTATGTTTGGGTGTTGAATGATGCAGGGTTGTGATGGGTCGATACT
CTTGGATTCAACCGCAACCATCGAGAGTGAAAAGTTCGCGGCTCCTAATAACAATTCGGCTAGAGGTTTCGAAGTGATCGACCAAATAAAGGCGGAGGTTGACAGAGTATGTGGACGTCC
CGTGGTTTCTTGTGCAGACATCTTGGCTATCACCGCTCGTGACTCTGTCGTTGCG
GTACGTCTAGTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACCATCAT
TTGCTTAGTTGATTTTCATGCGCCGTAAGACATTGCCAATCCGAATTAGGTGTTAACTTCTTTCATATTTCAGTTAGGAGGGCCTTCGTGGAAAGTACAACTCGGACGAAGAGATTCGAC
GACGGCGAGCAGGACGACGGCAAACAACGACATCCCTGCGCCGAACATGGACTTACCCGCCTTAATTAACAATTTCAAGAGACAAGGCCTGAAGGTCAAGGACTTG
GTNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAATAGGACATTCAATGACAGCAACATCAACCAGGCATTCGCAAAGAATCTCCGGTCCTACTGCCCGCGCACAGGAAGCGA
CTCTAACCTCGCAAGTTTAGATCCCACGCCTGCGCGTTTCGACACATTGTACTACAATAACCTGTTGACCCAGAAGGGCCTTCTTCACTCTGATCAGGCACTGTCAACTGGTGAATCCGC
ACTCGAGCTA
GTGAANNNNNNNNNNNNNNNNNNNNNAGCATTTTGGAAGGATTTCGCTAAATCGATGGTCAGGATGGGAAATATCAAGCCACTGACCGGAAACCAAGGTCAAATTCGCTC
GAATTGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCCTCACCCTCTTCCAAGCGCTTCTCATCTTGTCCCTCGCGGCCTCAACTCTTTCAACTCGTCCTTACAAGAATGGCCTCACGCCATACTTCTATGACTACGTTTGCATGCAG
GGTTGTGATGGGTCGATACTCTTGGATTCAACCGCAACCATCGAGAGTGAAAAGTTCGCGGCTCCTAATAACAATTCGGCTAGAGGTTTCGAAGTGATCGACCAAATAAAGGCGGAGGTT
GACAGAGTATGTGGACGTCCCGTGGTTTCTTGTGCAGACATCTTGGCTATCACCGCTCGTGACTCTGTCGTTGCG
TTAGGAGGGCCTTCGTGGAAAGTACAACTCGGACGAAGAGATTCG
ACGACGGCGAGCAGGACGACGGCAAACAACGACATCCCTGCGCCGAACATGGACTTACCCGCCTTAATTAACAATTTCAAGAGACAAGGCCTGAAGGTCAAGGACTTG
NNNAGGAATAGG
ACATTCAATGACAGCAACATCAACCAGGCATTCGCAAAGAATCTCCGGTCCTACTGCCCGCGCACAGGAAGCGACTCTAACCTCGCAAGTTTAGATCCCACGCCTGCGCGTTTCGACACA
TTGTACTACAATAACCTGTTGACCCAGAAGGGCCTTCTTCACTCTGATCAGGCACTGTCAACTGGTGAATCCGCACTCGAGCTA
NNAGCATTTTGGAAGGATTTCGCTAAATCGATGGTC
AGGATGGGAAATATCAAGCCACTGACCGGAAACCAAGGTCAAATTCGCTCGAATTGC

Retrieve as FASTA