Entry information : EglPrx45
Entry ID 10867
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2016-01-21 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-21 (Achraf Jemmat)
Peroxidase information: EglPrx45
Name EglPrx45
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx45
start..stop
S start..stop
EgrPrx45 669 0 1..322 1..322
EguPrx45 660 0 1..322 1..322
EcamPrx45 659 0 1..318 1..318
EgrPrx43 631 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 751..942 192 N° 3 1038..1200 163 N° 4 1447..1856 410
join(1..204,751..942,1038..1200,1447..1856)


exon

Literature and cross-references EglPrx45
Protein sequence: EglPrx45
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   35116.7 (32744.4)  
PI (pH):   %s   8.55 (8.39) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIDSTLSNTAEKDSPANNPSLRGFEVIDSAKARLETMCKGVVSCADILAFAARDSVEITGGFGYNVPAGRRDGRVSLAPETINLPLPSFNVNQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQRCPQNNDSTLVVPMDPPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARNPFIWKKIFAAAMVKMGKIGVLTGSAGEIRANCRVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTATCCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCACCAAGGTCAACTAAAAGCGTCGACTAATTTCCTTTCCTTTTTCCTTTGGTTGTATTTTTGTATGCAGAATAATGTGTCAACTAAGAGTTCA
TTAATTCATTGCAATTTACGCCACTCACATGCCATACCCACGTGCCGGTCTCATATGTAGAACATGAATTGACTACTACAAGCTTTTATGTCAATGAAGTATCTTTCGATTAATTTAACG
GAATTGTCATGACCTAATTAATAGATATGATANGTCTACTAATTATATTGCACATTCGAATTGGAATATGATACATACATTTATTAAAAGTTAATTGCTTAACTAGATGTGCCTAAATGC
ATTTAACAAGTTTAGATATTTCCGTGTAAATCTTGTTTAAATATGCTCCTTCTAAACTCAATGACCCTCACAGAAGTACCTTAGCTCTGTTTCGGGAATGGATTTCATTTGTGAGTTTTA
AGAAACATCGCGTGCTTTGATCCATCTTAGGGTTGTGAAGGTTCCGTGCTCATCGACTCCACTCTGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTC
GAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGTGCTGACATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATC
GTAATCCCGCAAACCCCT
TAACTCTGTATATTTACCAACTTGAGCATAAGTTCATCATACTAATAAACATGAGGCGTTCTGTTTTCTTTTTGTAGACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATG
GTAGAGTCTCTTTAGCTCCAGAGACTATAAACTTACCTCTCCCGTCTTTCAACGTCAATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTAGAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGATAAAAAATAGAACATCAAGATTATGTAGGAAAGAGTAACATTAGAGGAAAAAAATGCTCACAGGGAC
TTCTGTAATACTTGGCCCATTATGTGTTTGTAGGCAACTTACATTCTTGACTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTTACATTAAAAAAAAAAAAACTCGCTTCATGCGTG
TCACAGGAGCGCATACAATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGA
AGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATGGACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACAT
CAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACTCAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCGGCTGCAATGGTGAAGATGGGTAAAATCGGTG
TCTTGACAGGAAGTGCCGGGGAGATCCGAGCGAATTGCAGGGTCATCAATAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGTTGTGAAGGTTCCGTGCTCATCGACTCCACTCTG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATC
ACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTCCAGAGACTATAAACTTACCTCTC
CCGTCTTTCAACGTCAATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACAATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATG
GACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACT
CAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCGGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACAGGAAGTGCCGGGGAGATCCGAGCGAATTGCAGGGTCATC
AATAGCTAA

Retrieve as FASTA