Entry information : OsPrx77
Entry ID 1087
Creation 2005-07-21 (Filippo Passardi)
Last sequence changes 2005-07-21 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx77
Name OsPrx77
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx77
start..stop
S start..stop
BdiPrx31 622 0 1..334 1..334
HvPrx16 613 0 1..334 1..334
FpPrx01 611 0 1..334 1..334
SbPrx128 610 0 1..334 2..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9338738..9338971 234 N° 2 9338420..9338611 192 N° 3 9337896..9338061 166 N° 4 9337071..9337483 413
complement(join(9337071..9337483,9337896..9338061,9338420..9338611,9338738..9338 971))


exon

Literature and cross-references OsPrx77
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9FP11
DNA ref. GenBank:   NC_008399.1 (9338971..9337074)
Protein sequence: OsPrx77
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (307)
PWM (Da):   %s   36232.83 (33475.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.76 (4.75) Peptide Signal:   %s   cut: 28 range:28-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATGVLCSREFALCLACVLLAVPLLVAQDPSSLSLEHYSKTCPNYEHVVRTEMECAVRADSRNAALMLRLHFHDCFVQGCDGSVLLDDTATLIGEKKAEQNVNSLKGFELVDKIKQKLEAECPGTVSCADLLAIAARDAVVLVGGPYWDVPVGRLDSKKASLDLANRDIPTAQQGLVTLIAKFWEKGLDATDMVALVGSHTIGFARCANFRDRIYGDYEMTTKYSPISQPYLSKLKDICPLDGGDDNISAMDSHTAAAFDNAYFGTLVNGEGLLNSDQEMWSSVLGYSTADTVSKYWADADAFFKQFSDSMVKMGNITNPAGGEVRKNCRFVNT

Retrieve as FASTA  
Remarks chromosome 6. 14 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACAGGTGTTCTGTGCTCCAGGGAATTTGCTCTCTGCCTGGCTTGTGTGCTCCTGGCCGTGCCATTGCTAGTGGCTCAGGACCCTTCAAGCCTGAGCTTGGAGCACTACTCAAAG
ACCTGCCCGAATTATGAGCATGTCGTCCGGACTGAGATGGAATGTGCTGTGCGTGCGGATTCCCGCAATGCAGCTCTGATGCTTCGTCTTCATTTCCATGACTGTTTCGTTCAG
GTTAGC
ATTCAATCCATTTTCTCTCTTTTACTTTGCACAGATGCTAATCTTGTTCATCTGAACTTCAATGTGCGTAGTGGGAGTTGCAGAGTTTTCTCTGAAAAAATGTGAATATATCTGTTGCAG

GGTTGCGATGGATCAGTGCTGCTTGACGACACTGCGACCCTGATTGGAGAGAAGAAGGCAGAACAGAATGTCAACTCGCTGAAGGGGTTCGAGCTGGTTGACAAGATCAAGCAGAAGCTG
GAAGCTGAGTGCCCTGGAACAGTTTCCTGTGCAGACTTGCTTGCCATTGCAGCGAGGGACGCAGTTGTGCTG
GTAAACCTAACGATACCTATGTTCAGAATTGTGATTCATAAGCAGTAA
CTTATGTCAGACAGAGTTTGTCATGTGTTGTGCAACACATTAGCTCATTTTCGCTACTATCAGGTTCATATTAGACATTCTATTCAAGAAAACATGAACAGGCAGACATACATTTCAGGA
ATAACTCAATACACCATCGAGAAATTCAAGCACCCGTTTCACAATAACTATCTATTACCTCATAAAATCATTGTCTCCATTAGCATATTGTTTTGCCTGCAATCATGCCAGCATGTAGAA
CTTGCAAGCAATCAAAGAACGGTGCGTATTCCACATCAATGTTATTACAGAATGGAAATTTGTGTTGCAGGTTGGTGGGCCTTACTGGGATGTCCCAGTTGGAAGATTGGACTCCAAGAA
GGCAAGCCTGGACCTAGCAAACAGGGACATTCCCACTGCTCAACAGGGCCTTGTCACCCTCATTGCCAAGTTCTGGGAGAAGGGCCTCGATGCCACTGACATGGTAGCCCTTGTCG
GTAT
GTTCTTCTTCTCTCTTCAATGCTACAATTCTATCATTAGTTCAATTCAAATTAGCACCTGCCAGTGGCCTTATACATGAAAAATACTTTCGAAAAGTTGACATTATATCCAGGGTTTTTT
TTTAAAGGAGGGCAAAAGCTTTGCCTCGTATATTAATAGAGAGGAAACAAAGTACACAGCTGTATATACAGGGCTAGTCTAAAAAAACGACATGCCCGCAACAGAAAAGAGCTAAGTGAT
ATCCAGGGTGAAATTTGATCATATACCCTCCTATCCCCTCCTTTTAGATTGAAATGGAGAATTCACCCTCCTGACTTACATGCCAGTGAAATTAGATGACCCCCAAGTATGAATCAAATC
CTCAAATTGTGAACTGAAACCTTGTTGAATTTGTGAATTTGATCGAAGGATCCCACACAATCGGATTCGCCCGGTGCGCCAACTTCCGGGACAGGATCTACGGCGACTACGAGATGACGA
CCAAGTACAGCCCGATCTCCCAGCCCTACCTGAGCAAGCTCAAGGACATCTGCCCCCTGGACGGCGGCGACGACAACATCAGCGCCATGGACAGCCACACCGCCGCCGCCTTCGACAACG
CCTACTTCGGGACCCTCGTCAACGGCGAGGGCCTCCTCAACTCCGACCAGGAGATGTGGTCCAGCGTCCTCGGCTACTCCACGGCCGACACCGTCAGCAAGTACTGGGCCGACGCCGACG
CCTTCTTCAAGCAGTTCTCCGACTCCATGGTCAAGATGGGCAACATCACCAACCCTGCAGGTGGTGAGGTCAGGAAGAACTGCAGATTTGTCAACACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACAGGTGTTCTGTGCTCCAGGGAATTTGCTCTCTGCCTGGCTTGTGTGCTCCTGGCCGTGCCATTGCTAGTGGCTCAGGACCCTTCAAGCCTGAGCTTGGAGCACTACTCAAAG
ACCTGCCCGAATTATGAGCATGTCGTCCGGACTGAGATGGAATGTGCTGTGCGTGCGGATTCCCGCAATGCAGCTCTGATGCTTCGTCTTCATTTCCATGACTGTTTCGTTCAG
GGTTGC
GATGGATCAGTGCTGCTTGACGACACTGCGACCCTGATTGGAGAGAAGAAGGCAGAACAGAATGTCAACTCGCTGAAGGGGTTCGAGCTGGTTGACAAGATCAAGCAGAAGCTGGAAGCT
GAGTGCCCTGGAACAGTTTCCTGTGCAGACTTGCTTGCCATTGCAGCGAGGGACGCAGTTGTGCTG
GTTGGTGGGCCTTACTGGGATGTCCCAGTTGGAAGATTGGACTCCAAGAAGGCA
AGCCTGGACCTAGCAAACAGGGACATTCCCACTGCTCAACAGGGCCTTGTCACCCTCATTGCCAAGTTCTGGGAGAAGGGCCTCGATGCCACTGACATGGTAGCCCTTGTCG
GATCCCAC
ACAATCGGATTCGCCCGGTGCGCCAACTTCCGGGACAGGATCTACGGCGACTACGAGATGACGACCAAGTACAGCCCGATCTCCCAGCCCTACCTGAGCAAGCTCAAGGACATCTGCCCC
CTGGACGGCGGCGACGACAACATCAGCGCCATGGACAGCCACACCGCCGCCGCCTTCGACAACGCCTACTTCGGGACCCTCGTCAACGGCGAGGGCCTCCTCAACTCCGACCAGGAGATG
TGGTCCAGCGTCCTCGGCTACTCCACGGCCGACACCGTCAGCAAGTACTGGGCCGACGCCGACGCCTTCTTCAAGCAGTTCTCCGACTCCATGGTCAAGATGGGCAACATCACCAACCCT
GCAGGTGGTGAGGTCAGGAAGAACTGCAGATTTGTCAACACATGA

Retrieve as FASTA