Entry information : EglPrx54
Entry ID 10876
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2016-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-17 (Achraf Jemmat)
Peroxidase information: EglPrx54
Name EglPrx54
Class Class III peroxidase    [Orthogroup: Prx057]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx54
start..stop
S start..stop
EgrPrx54 677 0 1..333 1..333
EguPrx51 672 0 1..333 1..333
EgrPrx53 672 0 1..333 1..333
EglPrx53 648 0 1..333 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..228 228 N° 2 361..552 192 N° 3 679..843 165 N° 4 2076..2489 414
join(1..228,361..552,679..843,2076..2489)


exon

Literature and cross-references EglPrx54
Protein sequence: EglPrx54
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (304)
PWM (Da):   %s   35655.85 (32682.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.29 (5.93) Peptide Signal:   %s   cut: 30 range:30-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHSSTLSSPTVVALFAAALLFLLHPLNAELTADFYAKTCPDVSSIVQTVIHEALQYDPRITASLLRLHFHDCFVQGCDGSVLLDNSPTIKSEKDAAPNFNSARGFGVVDKIKAAIESTCPETVSCADILALAANASVYLSGGPYWTVLLGRRDSLTANQGLANVSIPSPFDSYANLTSKFYVLGLDITDLVTLSGAHTFGRAHCKSFTPRLYNFTKNGGPDPTLSPWYLTALQKLCPPNFNPKVITDLDPTTPNLFDNHYYSNLQKNDGLFETDQELYSxxxAATVPIVNSFSADQSAFFKSFTRSIVNMGNISPLTGSNGEIRCNCRKVNK

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCATTCTTCTACTCTTTCGTCGCCAACGGTGGTGGCCCTTTTTGCCGCCGCCTTGTTGTTTCTCCTCCATCCATTGAATGCTGAACTAACCGCTGATTTTTATGCAAAGACATGC
CCGGACGTGTCCAGCATCGTCCAGACCGTGATTCATGAGGCCCTTCAATATGACCCACGCATCACCGCCAGCCTCCTCCGTCTCCATTTTCACGATTGCTTCGTCCAA
GTGAGTCCCTAC
ACTAGATCAATTCCCATTGACAATGAGTTCCAACTTGCCGCATTCTTTTTACAGTACTTTCGATCTGATTATTGAGTTATTAGTCACGTAACCTAATGCTTGAGCATGACGTGTTTAAAG

GGGTGTGATGGATCGGTATTGCTGGACAATAGCCCAACCATAAAGAGCGAGAAAGATGCTGCTCCGAATTTTAATTCCGCAAGAGGGTTCGGTGTGGTGGACAAGATCAAAGCGGCTATT
GAGAGCACTTGTCCTGAGACTGTGTCTTGCGCTGACATCCTCGCCCTGGCTGCTAACGCTTCCGTTTATTTG
GTATATGTCGTTTTAGTCAAAGAAACATAAAACATATTTAAAGTATAC
TTAGGATTCGTTATTGTCGCTTGGCCTACACGAATTATAATTGTGTTTCTCTTGATTATCACTTTTATGAAATTGCAGTCAGGAGGTCCATATTGGACGGTGCTCTTGGGGAGGAGGGAC
AGCTTGACGGCGAACCAAGGGCTAGCGAACGTATCGATCCCCTCCCCTTTTGATAGCTATGCCAACCTCACTTCCAAGTTCTATGTTTTGGGCTTGGACATCACCGACCTTGTCACACTT
TCC
GACAAAATAGATTAACAGAGTGAAATGTAAGATTTTTGTCACATAACTTATTGGCACAAACATCGCATCACTTTCATTTAGCACATTTCAACTTCCTAATATGATCAAGGTCTCTTC
TTCATCTACTAGAAGGAATTTTAGTTAAGGATTAAGGGTTAATTTTTTTTAATCTAAAATTGAACTGTACCTGGGTCGTGCATGGGCTATGCACATTTACTAGAAGGAATTTTGGCTGAG
GATTAATGATTTCTTTTTTACCAAAAATTGAAAAAGTAGAGGATTGCCTATGACTTGAGATCGACTGACGTGCGTGCGTTGTGCCTAGACCATGCGATGTTGTGCATGGGTATGTACATA
TATTAGAAGGATTTTTGGCTAAAGGATTGAGGGTTTCTTTCAATCTAAAATTGAATAAGTAAAGGATTGCCTTCGACTTAATTTCAGGAGCAGTTGTGTATCATCACTACTCTAAAAAAG
ATAGATTATTTTAAAACAATTTTTTAATTATTTTTTTATTAAATAAAATAGTAATAGAAAATATTTATTGGGGGTAGGTATTATATAAATTAAATGGGCCAAGCAGGAATTTTAGGATGG
ATCCACGCAAGGGGATTTTAACTTTACTTTTCAGTTCAATCAAACTAACCCTATATGAATTACCATTTAATTCAAATGGATCTAAATCAAGCCCGTATCAGCAACTCTTTAAGTCATATC
TAGTATAACTTCNNNNNNNNNNNNGAAGAAGTGGTCAATGATGACACTTCATCGTTCAATTCATGATGAGGTTCATAGCGTTGAAACCATCGAATTAATGTAATATTTTCTTTGTTGTGA
TTTGTTTTCAATCAAACTAGTGTACTTTTATGTGTAATTTTTTTTATTACAAATTTGAAAAATATATTCGTGTTCAATGGGTAATTTTATATTCCTAATATCATTACAAGAGTATAAATA
TTGGAGGAGGATGCTATCAAAATTTGCAAGCCCCTCACATACTTGTATGAGAAATGCCAAGTATACTGAGGTCATTTGATAGAATCAATAAAATAAGTGATGTCACATATCGCTATTATT
TATTTATATTTTTACTAACGAGTTTGTTGCATATGTTTAGTATACAAATTCTATTAAGCATTCCTAGTATTGGTCTATTTATCCACCTTCACAATTGAGCTCTGCAGATATTTTGTTCTC
TTAGCTAATTATTCGTGCATATCATAATAAAACAGGGAGCTCACACCTTCGGACGTGCACATTGCAAGTCATTCACCCCTAGGCTGTACAACTTCACCAAAAATGGCGGCCCCGATCCCA
CCCTAAGCCCGTGGTACTTGACGGCTCTCCAGAAACTTTGCCCTCCAAACTTCAATCCTAAAGTCATCACCGACCTCGATCCGACGACCCCGAACTTGTTTGACAACCACTACTACTCCA
ACCTCCAGAAAAATGACGGGCTTTTTGAGACTGATCAAGAGCTGTACTCGNNNNNNNNNGCTGCGACAGTACCCATCGTCAACAGCTTCAGTGCCGACCAGAGTGCCTTCTTCAAGAGCT
TCACTCGGTCGATAGTAAACATGGGAAACATAAGTCCTCTCACCGGAAGTAACGGGGAGATCAGGTGCAATTGCAGGAAGGTCAATAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCATTCTTCTACTCTTTCGTCGCCAACGGTGGTGGCCCTTTTTGCCGCCGCCTTGTTGTTTCTCCTCCATCCATTGAATGCTGAACTAACCGCTGATTTTTATGCAAAGACATGC
CCGGACGTGTCCAGCATCGTCCAGACCGTGATTCATGAGGCCCTTCAATATGACCCACGCATCACCGCCAGCCTCCTCCGTCTCCATTTTCACGATTGCTTCGTCCAA
GGGTGTGATGGA
TCGGTATTGCTGGACAATAGCCCAACCATAAAGAGCGAGAAAGATGCTGCTCCGAATTTTAATTCCGCAAGAGGGTTCGGTGTGGTGGACAAGATCAAAGCGGCTATTGAGAGCACTTGT
CCTGAGACTGTGTCTTGCGCTGACATCCTCGCCCTGGCTGCTAACGCTTCCGTTTATTTG
TCAGGAGGTCCATATTGGACGGTGCTCTTGGGGAGGAGGGACAGCTTGACGGCGAACCAA
GGGCTAGCGAACGTATCGATCCCCTCCCCTTTTGATAGCTATGCCAACCTCACTTCCAAGTTCTATGTTTTGGGCTTGGACATCACCGACCTTGTCACACTTTCC
GGAGCTCACACCTTC
GGACGTGCACATTGCAAGTCATTCACCCCTAGGCTGTACAACTTCACCAAAAATGGCGGCCCCGATCCCACCCTAAGCCCGTGGTACTTGACGGCTCTCCAGAAACTTTGCCCTCCAAAC
TTCAATCCTAAAGTCATCACCGACCTCGATCCGACGACCCCGAACTTGTTTGACAACCACTACTACTCCAACCTCCAGAAAAATGACGGGCTTTTTGAGACTGATCAAGAGCTGTACTCG
NNNNNNNNNGCTGCGACAGTACCCATCGTCAACAGCTTCAGTGCCGACCAGAGTGCCTTCTTCAAGAGCTTCACTCGGTCGATAGTAAACATGGGAAACATAAGTCCTCTCACCGGAAGT
AACGGGGAGATCAGGTGCAATTGCAGGAAGGTCAATAAG

Retrieve as FASTA