Entry information : EglPrx59
Entry ID 10881
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EglPrx59
Name EglPrx59
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx59
start..stop
S start..stop
EgrPrx59 670 0 1..332 1..332
EguPrx59 663 0 1..332 1..332
EcamPrx59 568 0 1..332 3..334
MePrx135 477 4e-171 1..331 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 948..1121 174 N° 3 1227..1401 175 N° 4 1802..2232 431
join(1..219,948..1121,1227..1401,1802..2232)


exon

Literature and cross-references EglPrx59
Protein sequence: EglPrx59
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (306)
PWM (Da):   %s   35125.43 (32201.9)  
PI (pH):   %s   7.68 (6.34) Peptide Signal:   %s   cut: 27 range:27-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRGASFRSWSLRWVVLLICFVGGKSQLTTDFYSTSCPNLLSIVRKQVQNAIKAEMRMGASLLRLHFHDCFVNGCDGSVLLDGSDGEKFAGPNLNSARGFDVVDNIKTAVESSCSGVVSCADILAIAARDSHVQSGGPTWKVPLGRRDGLVANQTGSNNGLPAPFDPLDTIISKFAAVGLNVTDVVALSGGHTIGLARCATFSNRLFNFSANSGSDPTLDTTMTSDLQSLCPVNGDGNKTTALDRNSTDLFDNHYFKNLAVNKGLLSSDQVLYSGDSSTASSTTKSLVESYGSNPNLFITDFTNSMIKMGSISPLTGSKGEIRKNCRVVNSS

Retrieve as FASTA  
Remarks Complete sequence from NGS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGGTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACTAGCTGTCCTAATCTG
CTTAGCATAGTAAGGAAACAAGTTCAAAATGCTATCAAGGCTGAAATGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCATGATTGCTTTGTCAAT
GTATGTCATGTGTTTAATANN
NNNAACTTGATCGTTACCGTACCATGCAATCAACGACTAGGTTTTTTACGTGATCAATTATATAAATTGTTGTTTCGATTTTGTGTTATTGTTCTTCTAAGTGGGCAGTTTCTTGTAATT
CGTAAATATTAATAAGCTTGAGATATCGGTTCTCTTGTTCGTAGGTTCTATGTAGACTCGAATAGGTTTTTAACAAGTGGAAATAATTAGGAGNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNTTTGTCCCTAAGCAATTTCAAATGGTAAATATGAGTAAAATGCTTTTTCGTGATTGATTTTATGTGAAACTAATATGAGCTATCATATTAGAAACACTAGGTT
CTAGGAACCCAATGCACTTGATGTGCCACGGCCGTTAAATCATGTGAATTTCCCGCAAACTCAAACAAAAGATTGATGCACCTGGCAAGGGACATCATTGTTTCGCAAAATAAGTTAGTG
AACAAAAAAGGTACTTCTTGACCATTCCAAGAACGAGAAAGTCAATCTTCTAATCCTCTTTTTGGAAAAGTAAGTTACCTGCATGTTAGTTTCCTCAGTCATAGAGGCTACCCATTCAAT
CGTCCTCTTTTCCCCATCTTACATTGACTTATCAGCCCTTCATGCTTTCATCATCATTCATGGCTTATATGTTCTCCTGTGAATACTTCACTCTGCTCACACACCAGGGATGCGATGGAT
CGGTTCTCCTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACAACATCAAAACTGCTGTGGAGAGTTCGTGCAGCGGCGTTG
TATCGTGTGCCGACATCTTAGCCATAGCCGCCAGAGATTCC
TCCACCAAAAAATACAAGAATCAACGGTACCCCGTAAACTATAAATAATTCGGTCCACTGTATTCATCGTAAACTCGGT
AAGAAGGTAACTGTATCTGATGGATCCATGTGCAGAGCGGGGGCCCGACATGGAAAGTTCCACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACAATGGCCTTCCTG
CTCCTTTCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCACAGATGTGGTAGCTTTATCAG
GTACTCTTCTTTTTCTCTTCCTTTTTTCTTTCTCTCTTT
GGATCAGTGCTTTATCCGGTACTTTGAGGACACTCCTCAGTCATTCTAATTTCTATACAAACTGCGTATTGGTATCCCTCGTTCAATCAAGAGGCTAGTTAGTGTCTACCATGTTTGATA
TTTTAACATCCATCTAAAATCAAAGTGATTGTAGTTACTGATCACGCTTAAATTAGGCAACAAAACTCTGACGGCGTTGTCACCTCTCTGTATGTTCATATCGAATCATGCAGATCTTGT
TGTAAATTATAATCATTTCCAGATCCATCTGAAGTTTCCTGAGAGAGAGCATGTGCAACTCTTAATGGTGTATAGGATGATCATTTCATGCACTGCTGAACAAAAAGAGGTTTATGTACA
GGTGGTCATACAATTGGATTAGCAAGGTGCGCCACCTTCAGCAACAGATTGTTCAACTTTTCGGCGAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGC
CTATGCCCTGTGAATGGCGACGGAAACAAGACAACGGCCCTAGACCGCAACTCAACCGATCTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGAT
CAGGTTCTCTATTCTGGTGACAGCAGCACAGCCAGTTCTACTACAAAAAGTCTAGTAGAATCCTATGGCAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATG
GGAAGCATCAGTCCACTCACTGGTTCAAAGGGCGAGATTCGGAAGAACTGTAGAGTGGTTAACTCTTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGGTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACTAGCTGTCCTAATCTG
CTTAGCATAGTAAGGAAACAAGTTCAAAATGCTATCAAGGCTGAAATGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCATGATTGCTTTGTCAAT
GGATGCGATGGATCGGTTCTC
CTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACAACATCAAAACTGCTGTGGAGAGTTCGTGCAGCGGCGTTGTATCGTGT
GCCGACATCTTAGCCATAGCCGCCAGAGATTCC
CATGTGCAGAGCGGGGGCCCGACATGGAAAGTTCCACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACAATGGC
CTTCCTGCTCCTTTCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCACAGATGTGGTAGCTTTATCAG
GTGGTCATACAATTGGATTAGCAAGGTGCGCC
ACCTTCAGCAACAGATTGTTCAACTTTTCGGCGAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGCCTATGCCCTGTGAATGGCGACGGAAACAAGACA
ACGGCCCTAGACCGCAACTCAACCGATCTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGATCAGGTTCTCTATTCTGGTGACAGCAGCACAGCC
AGTTCTACTACAAAAAGTCTAGTAGAATCCTATGGCAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATGGGAAGCATCAGTCCACTCACTGGTTCAAAGGGC
GAGATTCGGAAGAACTGTAGAGTGGTTAACTCTTCATGA

Retrieve as FASTA