Entry information : EglPrx62
Entry ID 10884
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EglPrx62
Name EglPrx62
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx62
start..stop
S start..stop
EgrPrx62 735 0 1..363 1..363
EguPrx62 724 0 1..363 1..363
EcamPrx62 656 0 1..331 1..331
EguPrx63 597 0 1..360 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..231 231 N° 2 407..586 180 N° 3 685..844 160 N° 4 970..1490 521
join(1..231,407..586,685..844,970..1490)


exon

Literature and cross-references EglPrx62
Protein sequence: EglPrx62
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (335)
PWM (Da):   %s   38270.8 (35666.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.13 (9.09) Peptide Signal:   %s   cut: 29 range:29-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLRAGAALGLALIGLVLASLSGSCHGALQVGFYNGKCRVSDVEAIVAGVVAARFSKDPTVAPALLRMQFHDCFVTGCDASILLDGKSSEKTALPNLSVKGYDVIDSAKAAVETICPGVVSCADIIVMATRDAVSLSGGGRYRVETGRKDGLVSLASNVNLPPPSISVNDSIAAFAQKGLTVSDMVLLLGGHTIGIAHCSLFQDRLYNYQNTxKPDPTMDPSLASALRSTCPNKQTNVDNIVNLDQDPLSSSIVDNSFYKQILARRGILQIDQEIALDRQTKDIVGAIAGRLDFSTRFGQAMVKLGTLQNGAPGEIRQSCRAINTARKLPTSKDKQRMGRTGWTRWSGDPRALSIQKRGSSD

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGCTGCGAGCAGGTGCTGCTTTGGGACTGGCCCTGATCGGCCTCGTGTTGGCGAGCCTGAGCGGGTCTTGCCACGGTGCTCTTCAGGTCGGGTTCTACAATGGCAAATGTAGG
GTCTCGGATGTCGAGGCCATCGTGGCCGGCGTCGTGGCGGCCAGGTTCAGCAAGGACCCCACCGTCGCCCCCGCTCTCCTCCGCATGCAGTTTCATGATTGCTTCGTCACT
GTAAGCTAA
TTAGCCTAAATTACTTCATGTAAAGCTACTTAAATGTTCAATTTGGTTCCCCCGCACGTGCTTTAGAACTAGTCTATTGACTAATAAAGAAATTATGTAGATGGATGGGATTGTGTAAGA
CCGGCTCGTTTTGTATGTTAAAATGTTACAATGACTAAATAATTAGGGCTGCGACGCCTCCATTCTTCTGGACGGAAAATCGAGCGAGAAGACTGCGCTGCCAAATTTGAGCGTCAAGGG
CTACGATGTCATTGACTCCGCAAAGGCTGCCGTGGAGACCATATGCCCCGGGGTTGTTTCCTGCGCCGATATCATTGTCATGGCAACTAGAGATGCCGTGTCCCTG
CCAGTGACATTCTG
CTCTTCTCATATGCTATACTTATATACACATTGGCTTAGTAAATTTCATGACGTACGCGTGAGACACATGCTCAAATATTGCAGAGCGGAGGAGGTCGGTACAGGGTAGAAACGGGACGG
AAAGACGGGCTCGTATCGCTCGCGTCCAACGTCAATCTCCCCCCTCCCTCCATCTCCGTCAATGACTCCATCGCGGCATTCGCTCAAAAAGGACTCACCGTTTCCGACATGGTCCTTCTT
CTAG
GTACGTATATGCAGCATCGTCGTCCCCAATCAATTGAAAACCCCAGATCCATGCAAATAAGTTCGAAAGTTGTAGTCTGGTATGGTGTTTGTTCTTATAAAAAACTGCTACTGGTC
GTGTCCTAGGTGGCCACACGATCGGCATTGCTCACTGCTCGCTCTTCCAAGACCGGCTTTACAATTACCAGAATACCNGGAAACCTGACCCAACCATGGACCCTTCCTTGGCTTCCGCCC
TAAGGTCGACGTGCCCTAACAAGCAGACTAACGTCGACAACATTGTCAATCTCGACCAGGATCCTCTGAGCTCATCGATCGTCGACAACTCCTTCTACAAGCAGATACTCGCCCGTAGAG
GGATTCTGCAGATCGATCAGGAGATCGCGCTGGACAGGCAGACCAAGGACATTGTGGGAGCGATCGCCGGCAGACTTGACTTCTCGACTAGGTTTGGCCAAGCCATGGTTAAGTTGGGCA
CACTCCAGAATGGCGCTCCTGGGGAGATAAGGCAATCCTGCAGAGCTATCAATACGGCTCGTAAGCTGCCTACTTCCAAAGATAAGCAGAGGATGGGCCGGACAGGGTGGACGCGGTGGA
GCGGTGACCCGAGAGCCCTTTCGATTCAGAAGCGTGGCTCTTCAGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGCTGCGAGCAGGTGCTGCTTTGGGACTGGCCCTGATCGGCCTCGTGTTGGCGAGCCTGAGCGGGTCTTGCCACGGTGCTCTTCAGGTCGGGTTCTACAATGGCAAATGTAGG
GTCTCGGATGTCGAGGCCATCGTGGCCGGCGTCGTGGCGGCCAGGTTCAGCAAGGACCCCACCGTCGCCCCCGCTCTCCTCCGCATGCAGTTTCATGATTGCTTCGTCACT
GGCTGCGAC
GCCTCCATTCTTCTGGACGGAAAATCGAGCGAGAAGACTGCGCTGCCAAATTTGAGCGTCAAGGGCTACGATGTCATTGACTCCGCAAAGGCTGCCGTGGAGACCATATGCCCCGGGGTT
GTTTCCTGCGCCGATATCATTGTCATGGCAACTAGAGATGCCGTGTCCCTG
AGCGGAGGAGGTCGGTACAGGGTAGAAACGGGACGGAAAGACGGGCTCGTATCGCTCGCGTCCAACGTC
AATCTCCCCCCTCCCTCCATCTCCGTCAATGACTCCATCGCGGCATTCGCTCAAAAAGGACTCACCGTTTCCGACATGGTCCTTCTTCTAG
GTGGCCACACGATCGGCATTGCTCACTGC
TCGCTCTTCCAAGACCGGCTTTACAATTACCAGAATACCNGGAAACCTGACCCAACCATGGACCCTTCCTTGGCTTCCGCCCTAAGGTCGACGTGCCCTAACAAGCAGACTAACGTCGAC
AACATTGTCAATCTCGACCAGGATCCTCTGAGCTCATCGATCGTCGACAACTCCTTCTACAAGCAGATACTCGCCCGTAGAGGGATTCTGCAGATCGATCAGGAGATCGCGCTGGACAGG
CAGACCAAGGACATTGTGGGAGCGATCGCCGGCAGACTTGACTTCTCGACTAGGTTTGGCCAAGCCATGGTTAAGTTGGGCACACTCCAGAATGGCGCTCCTGGGGAGATAAGGCAATCC
TGCAGAGCTATCAATACGGCTCGTAAGCTGCCTACTTCCAAAGATAAGCAGAGGATGGGCCGGACAGGGTGGACGCGGTGGAGCGGTGACCCGAGAGCCCTTTCGATTCAGAAGCGTGGC
TCTTCAGACTGA

Retrieve as FASTA