Entry information : EglPrx67
Entry ID 10889
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-25 (Christophe Dunand)
Peroxidase information: EglPrx67
Name EglPrx67
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx67
start..stop
S start..stop
EgrPrx67 660 0 1..325 1..325
EcamPrx67 649 0 1..325 1..325
EguPrx68 648 0 1..325 1..325
EgrPrx68 645 0 1..325 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..207 207 N° 2 310..507 198 N° 3 1081..1246 166 N° 4 1808..2214 407
join(1..207,310..507,1081..1246,1808..2214)


exon

Literature and cross-references EglPrx67
Protein sequence: EglPrx67
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (303)
PWM (Da):   %s   34904.84 (32539.6)  
PI (pH):   %s   9.64 (9.63) Peptide Signal:   %s   cut: 23 range:23-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARRFLVSCLSFALLLSAVSAQLRTDFYKNTCPNVESLVRSAVTKKFQQTFVTAPATLRLLFHDCFVRGCDGSVLIASPTNNAEKDHPDDLSLAGDGFDTVIKAKAAVDSVPQCKNKVSCADILALAARDVVSLAGGPFYSVELGRRDGRISTKLSVQHNLPQPGSKLDQLNSMFSSHGLxxxxMIALSGAHTIGFSHCGKFSKRIYNFSPRSSVDPTLNFGYALQLRQMCPIKVDPRIAINMDPTTPQTFDNAYYKNLQQGKGLFVSDQTLFSDPRSRATVTLFASNNAAFRQAFVTAITKMGRIGVKTGNQGEIRIDCTRPN

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCGTAGGTTTCTCGTGTCGTGCCTGAGCTTTGCCCTTCTGTTAAGTGCAGTCTCGGCTCAGCTCAGGACGGATTTCTACAAGAACACGTGCCCGAACGTCGAGTCCCTCGTC
CGGTCGGCCGTGACCAAGAAGTTCCAGCAGACCTTCGTCACCGCCCCTGCAACTCTCCGCCTCTTGTTCCACGATTGCTTCGTCAGG
GTTGGTTTTGAAACAAAGTATTCTATACATAAT
AATGTTGGCTTGATTGTTAATTGTTTGCTTCTTCTTCTTCTTTTTCGTTCATTTTGGGGATTTGATTAGGGATGCGATGGTTCAGTGCTCATAGCGTCGCCCACCAACAACGCCGAGAAA
GACCATCCCGATGACCTGTCGCTCGCCGGCGACGGGTTCGACACTGTGATCAAAGCTAAGGCAGCAGTGGATAGTGTTCCTCAGTGCAAAAACAAAGTCTCTTGTGCCGATATCTTGGCT
CTTGCCGCTAGAGATGTCGTTTCGTTG
GTACGATAAGGGCCCCCCACTGAACTCCTTTCCCAATTTTTTCATTTCACGAAATCGAGCATCCATCTAACTTTTTCAGTCCGGTGAAAAGCA
AACCATTCAAATTGAGCTCGAAAATTTATGAAAAATTACTTTAGAGGCACGTAGTTTTCGAACCCTTATAGAGTGCTCGACTACTTTCTTAGAATATGCCAATATGCTTTTCTTTTCCAC
GACATGACGAAATTATAATATGCTTTTGTTTTGTACCAAAGAAAAATAATAGTCTATTCATATAAAATTTTTAGTACAAATTTCTTTTCTTGTTACACTGAAAAACCATTGGGTCCCTTT
CATAATGCCTGTCCTTTTCTCCCTCCTCCACATCAATAGCATGTACGGAAGTTTGATGCAACGGGTTAACAAGAAAGTCGACAACAAGCACCACCCAACGCTACTTTTTCCCGTCAAACC
ACTCAAAATTGCGAATAATTTTCGTCCNNNNNNNNNNTTTCATTTTAGCAAATTGATAATGTCGCACGGTCATTTCATAATCACTTGCTATTCTTTGCAAAATTTTGAAATTTTGTGTAG

GCAGGGGGGCCGTTCTATAGTGTTGAATTGGGGAGACGCGATGGAAGAATATCAACTAAACTTAGTGTCCAACACAATCTTCCTCAGCCTGGTTCCAAATTGGACCAGCTCAATTCCATG
TTCTCTTCTCATGGTCTNNNNNNNNNNNNNATGATCGCCTTATCAG
GTAATTAATTACATCTTATTATGAGATTTGGTGGATTACTAAGCAAATAGATCAAGAGACCACATAATTACTTG
CTAATCTCATATATATATTACTTAAGCATTTTGAACCCACAAAGCCAGCATAAGCTCTAAATTTTTTTTTATAATGTAATTTGCAAAATATACATGAAAGAGTAATTGGGTAAGCCGTCA
AGTAAAGATGCATGACAACTTCCACTTTATGCAACACATCCTTGTCTATCATCTAATTATAATCATAGGAAGCGGAAGAAAAGTGTTCATAGGTACCCAATGGCTTCTTATTGGAGCAAT
GTGCTAGACAACTAGGCAAGCATTGTAGTCCACTTGATTACCTCTAGATTCATTTATATAGCATATCATAGCTCAGACGATTGTAGTCTAATGTTTATCATAGTCCAATCATACTCTCTC
TCATGATAGAATAGCATATGTAACTATTAAGCCGGTAGTCATTGACAAGTTCACAAAATTATTCAATTTCAAACGCTAAAGTTTGATTTTTCCCGGGTAACTCACATCGTAACCACTGCG
TTTGTAGGCGCGCACACGATTGGATTCTCTCACTGCGGCAAATTCTCCAAGCGGATCTACAACTTCAGCCCGAGAAGCTCGGTCGATCCGACCCTGAACTTCGGCTACGCCTTGCAGCTG
AGGCAGATGTGCCCGATCAAGGTGGACCCCCGGATCGCCATCAACATGGACCCCACAACGCCTCAGACGTTCGACAACGCCTACTACAAGAACCTCCAACAAGGAAAGGGCCTCTTCGTC
TCCGACCAGACATTGTTCTCCGACCCGAGATCGAGGGCCACGGTCACCCTGTTCGCATCAAACAACGCGGCGTTCCGACAGGCCTTCGTCACTGCGATCACAAAGATGGGTCGGATCGGG
GTCAAGACCGGGAACCAGGGTGAGATTAGGATTGATTGCACTCGCCCCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCGTAGGTTTCTCGTGTCGTGCCTGAGCTTTGCCCTTCTGTTAAGTGCAGTCTCGGCTCAGCTCAGGACGGATTTCTACAAGAACACGTGCCCGAACGTCGAGTCCCTCGTC
CGGTCGGCCGTGACCAAGAAGTTCCAGCAGACCTTCGTCACCGCCCCTGCAACTCTCCGCCTCTTGTTCCACGATTGCTTCGTCAGG
GGATGCGATGGTTCAGTGCTCATAGCGTCGCCC
ACCAACAACGCCGAGAAAGACCATCCCGATGACCTGTCGCTCGCCGGCGACGGGTTCGACACTGTGATCAAAGCTAAGGCAGCAGTGGATAGTGTTCCTCAGTGCAAAAACAAAGTCTCT
TGTGCCGATATCTTGGCTCTTGCCGCTAGAGATGTCGTTTCGTTG
GCAGGGGGGCCGTTCTATAGTGTTGAATTGGGGAGACGCGATGGAAGAATATCAACTAAACTTAGTGTCCAACAC
AATCTTCCTCAGCCTGGTTCCAAATTGGACCAGCTCAATTCCATGTTCTCTTCTCATGGTCTNNNNNNNNNNNNNATGATCGCCTTATCAG
GCGCGCACACGATTGGATTCTCTCACTGC
GGCAAATTCTCCAAGCGGATCTACAACTTCAGCCCGAGAAGCTCGGTCGATCCGACCCTGAACTTCGGCTACGCCTTGCAGCTGAGGCAGATGTGCCCGATCAAGGTGGACCCCCGGATC
GCCATCAACATGGACCCCACAACGCCTCAGACGTTCGACAACGCCTACTACAAGAACCTCCAACAAGGAAAGGGCCTCTTCGTCTCCGACCAGACATTGTTCTCCGACCCGAGATCGAGG
GCCACGGTCACCCTGTTCGCATCAAACAACGCGGCGTTCCGACAGGCCTTCGTCACTGCGATCACAAAGATGGGTCGGATCGGGGTCAAGACCGGGAACCAGGGTGAGATTAGGATTGAT
TGCACTCGCCCCAACTAG

Retrieve as FASTA