Entry information : EglPrx[P]77
Entry ID 10899
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-08 (Christophe Dunand)
Peroxidase information: EglPrx[P]77
Name EglPrx[P]77
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]77
start..stop
S start..stop
EgrPrx[P]77 160 5e-53 1..94 1..111
EglPrx[P]79 128 1e-40 2..76 1..92
EgrPrx[P]79 124 4e-38 1..76 1..93
EcamPrx78 128 6e-38 1..76 13..105
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..210 210 N° 2 262..333 72  
join(1..210,262..333)


exon

Literature and cross-references EglPrx[P]77
Protein sequence: EglPrx[P]77
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   94 (73)
PWM (Da):   %s   10034.04 (7844.9)  
PI (pH):   %s   10 (10.24) Peptide Signal:   %s   cut: 22 range:22-94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CSSTLFIALILICSQPNRSAAxADANPTGRHRQMSFDYYTKSCPQIKQLIGSVTSQQFKEAPISGPATIRSSKPGSCSTNTFSLMYPFKKALFT

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short PS due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACCGATCCGCCGCNNNNGCTGATGCCAATCCCACGGGCCGCCACCGCCAGATGTCATTTGACTACTACACC
AAGTCGTGCCCCCAGATCAAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGATCTCCGGGCCGGCCACCATCCGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNGTTCTTCAAAGCCTGGTAGTTGTTCTACGAACACTTTCTCTTTAATGTATCCATTCAAGAAGGCGCTCTTCACA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACCGATCCGCCGCNNNNGCTGATGCCAATCCCACGGGCCGCCACCGCCAGATGTCATTTGACTACTACACC
AAGTCGTGCCCCCAGATCAAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGATCTCCGGGCCGGCCACCATCCGN
TCTTCAAAGCCTGGTAGTTGTTCTACGAAC
ACTTTCTCTTTAATGTATCCATTCAAGAAGGCGCTCTTCACA

Retrieve as FASTA