Entry information : OsPrx80
Entry ID 1090
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx80
Name OsPrx80
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx80
start..stop
S start..stop
OsPrx78 554 0 1..324 1..330
SbPrx145 519 0 23..324 28..329
SiPrx30 513 0 20..324 25..329
SbPrx130 510 0 18..324 33..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16678371..16678577 207 N° 2 16678750..16679517 768  
join(16678371..16678577,16678750..16679517)


exon

Literature and cross-references OsPrx80
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1L3
DNA ref. GenBank:   NC_008399.1 (16678371..16679514)
Protein sequence: OsPrx80
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   34506.37 (32385.1)  
PI (pH):   %s   7.31 (6.99) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAITKCCVLLLVPLVAVLVAADQLRVDYYSETCPNVEAIVREEMERIIAAAPSLAGPLLRLHFHDCFVRGCDASVLLSSAGGNTAERDAKPNKSLRGFGSVERVKARLETACPGTVSCADVLALMARDAVVLARGPSWPVTLGRRDGRASSAGEAAASLPPADGDIPTLARVFASNGLDLKDLAVLSGAHTLGTAHCPSYAGRLYNFTGKGDADPSLDGEYAGKLRTRCRSLTDDGMPSEMDPGSYKTFDTSYYRHVAKRRGLFSSDASLLTDATTRGYVQRIATGKFDDEFFRDFGESMTKMGNVAVLTGADGEIRKKCYVIN*

Retrieve as FASTA  
Remarks chromosome 6. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCACCAAGTGCTGTGTATTGCTGCTTGTTCCGTTGGTCGCCGTGCTCGTAGCGGCTGATCAGCTCCGCGTCGACTACTACAGCGAGACGTGCCCGAACGTCGAGGCGATCGTC
CGCGAGGAGATGGAGAGGATCATCGCCGCCGCGCCCAGCCTCGCCGGTCCGCTGCTTCGCCTCCATTTCCATGACTGCTTCGTCAGG
GTACGCAGATATATCGCATAAAAAAATTTCTCG
AGATATCTAAATTTTACATTAAAATTATTTTACCTCACACCAAATTTTACACTGAACTACATGGTATCTTATAAGGATGATAAAATTATCCACGTATATATACACGGCGCCATTGACCGT
GGGTCGACATTGCATGCAGGGTTGCGACGCGTCTGTGCTGCTGAGCTCCGCCGGCGGCAACACGGCGGAGCGGGACGCGAAGCCGAACAAGAGCCTCCGGGGATTCGGCTCCGTGGAGCG
GGTGAAGGCGAGGCTGGAGACGGCGTGCCCGGGCACCGTCTCCTGCGCCGACGTGCTCGCGCTCATGGCGCGCGACGCCGTCGTTCTGGCCAGGGGCCCGTCCTGGCCGGTCACCCTCGG
CAGGAGGGACGGCAGGGCGTCCAGCGCCGGCGAGGCCGCCGCCAGCCTGCCCCCGGCGGACGGCGACATCCCGACGCTCGCCAGGGTCTTCGCCTCCAACGGCCTCGACCTCAAGGACCT
CGCCGTGCTCTCCGGCGCGCACACCCTCGGCACGGCGCACTGCCCGTCCTACGCCGGCCGGCTCTACAACTTCACCGGCAAGGGCGACGCCGACCCGTCGCTGGACGGCGAGTACGCCGG
CAAGCTGAGGACGAGGTGCAGGAGCCTCACCGACGACGGCATGCCGTCGGAGATGGACCCCGGCAGCTACAAGACGTTCGACACCAGCTACTACCGCCATGTCGCCAAGCGGAGGGGGCT
CTTCTCCTCCGACGCCTCGCTCCTCACCGACGCCACCACCAGGGGCTACGTGCAGCGTATCGCCACCGGCAAGTTCGACGACGAGTTCTTCAGGGACTTCGGCGAGTCCATGACCAAGAT
GGGCAACGTCGCCGTGCTCACCGGAGCCGACGGCGAGATCAGGAAGAAGTGCTACGTCATCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCACCAAGTGCTGTGTATTGCTGCTTGTTCCGTTGGTCGCCGTGCTCGTAGCGGCTGATCAGCTCCGCGTCGACTACTACAGCGAGACGTGCCCGAACGTCGAGGCGATCGTC
CGCGAGGAGATGGAGAGGATCATCGCCGCCGCGCCCAGCCTCGCCGGTCCGCTGCTTCGCCTCCATTTCCATGACTGCTTCGTCAGG
GGTTGCGACGCGTCTGTGCTGCTGAGCTCCGCC
GGCGGCAACACGGCGGAGCGGGACGCGAAGCCGAACAAGAGCCTCCGGGGATTCGGCTCCGTGGAGCGGGTGAAGGCGAGGCTGGAGACGGCGTGCCCGGGCACCGTCTCCTGCGCCGAC
GTGCTCGCGCTCATGGCGCGCGACGCCGTCGTTCTGGCCAGGGGCCCGTCCTGGCCGGTCACCCTCGGCAGGAGGGACGGCAGGGCGTCCAGCGCCGGCGAGGCCGCCGCCAGCCTGCCC
CCGGCGGACGGCGACATCCCGACGCTCGCCAGGGTCTTCGCCTCCAACGGCCTCGACCTCAAGGACCTCGCCGTGCTCTCCGGCGCGCACACCCTCGGCACGGCGCACTGCCCGTCCTAC
GCCGGCCGGCTCTACAACTTCACCGGCAAGGGCGACGCCGACCCGTCGCTGGACGGCGAGTACGCCGGCAAGCTGAGGACGAGGTGCAGGAGCCTCACCGACGACGGCATGCCGTCGGAG
ATGGACCCCGGCAGCTACAAGACGTTCGACACCAGCTACTACCGCCATGTCGCCAAGCGGAGGGGGCTCTTCTCCTCCGACGCCTCGCTCCTCACCGACGCCACCACCAGGGGCTACGTG
CAGCGTATCGCCACCGGCAAGTTCGACGACGAGTTCTTCAGGGACTTCGGCGAGTCCATGACCAAGATGGGCAACGTCGCCGTGCTCACCGGAGCCGACGGCGAGATCAGGAAGAAGTGC
TACGTCATCAACTAA

Retrieve as FASTA