Entry information : EglPrx[P]79
Entry ID 10901
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EglPrx[P]79
Name EglPrx[P]79
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]79
start..stop
S start..stop
EgrPrx[P]79 202 5e-69 1..110 2..111
EcamPrx78 199 5e-65 1..110 14..123
EgrPrx81 197 2e-64 1..110 14..123
EglPrx81 197 3e-64 1..110 14..123
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..246 246 N° 2 770..853 84  
join(1..246,770..853)


exon

Literature and cross-references EglPrx[P]79
Protein sequence: EglPrx[P]79
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   110 (90)
PWM (Da):   %s   11916.11 (9800.0)  
PI (pH):   %s   8.89 (8.74) Peptide Signal:   %s   cut: 21 range:21-110
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SSTLFIALILICSQPNRSTAAATADAMGRHRQMSFDYYAKSCPQVKQLIGSVTSQQFKEAPVSGPATIRLFFHDCFVEVKSLSILISSKPGSKELAEKDAIDNKDLRAEG

Retrieve as FASTA  
Remarks Pseudogene sequence from NGS. 5' end is missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACCGATCCACCGCAGCTGCTACCGCCGATGCCATGGGCCGCCACCGCCAGATGTCGTTTGACTACTACGCCAAG
TCGTGCCCCCAGGTCAAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCCGGGCCGGCCACCATCCGGCTCTTCTTCCATGACTGCTTCGTTGAGGTAAAA
TCTCTC
TCTCTCTCTCTCTCTCTCTCTCTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGAGCAGCTCCCCACATTTTG
AGCATCTTTTGTTATCTACGGTGACCGAATCCTTGCATATTCTTGTTTCTACACGAATGAGTCCGTATACAACATCACTAATAAGAAATTACAGTTTTCATCGGCTAATCTTACCAAAAA
TTCAATTCAACCCTCCGGTGAGTGTTTCGTGTTTTGTTATTATTGCATTCCCCGAACCCGCNNNNNNNNNNNNNNNNNNNNNNNNNNGCATGGGTCCCGAGTCGATAATTCTCTTCATTT
TCATAGCAAGCGAGAGAAATTACCATGAAAAACATGGAGAATCATCAACTAGCGAGATTACTATCGGTAAACGCCGTTCATTTGTTAATCAATCGAGTAGGGCGATAATCCTAGCGTAGA
AACTACTGACTCTGCATGAGTTATGACCACTGTNNNNNNNNNNNNNNNNTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTT
GAGGGCGGAGGGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACCGATCCACCGCAGCTGCTACCGCCGATGCCATGGGCCGCCACCGCCAGATGTCGTTTGACTACTACGCCAAG
TCGTGCCCCCAGGTCAAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCCGGGCCGGCCACCATCCGGCTCTTCTTCCATGACTGCTTCGTTGAGGTAAAA
TCTCTC
TCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGA

Retrieve as FASTA