Entry information : EglPrx[P]80
Entry ID 10902
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EglPrx[P]80
Name EglPrx[P]80
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]80
start..stop
S start..stop
EgrPrx[P]80 164 4e-55 1..85 1..85
EguPrx[P]80 155 5e-52 1..85 1..85
EgrPrx[P]79 108 4e-32 3..85 79..154
EcamPrx[P]80 105 3e-31 3..75 91..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..147 147 N° 2 719..826 108  
join(1..147,719..826)


exon

Literature and cross-references EglPrx[P]80
Protein sequence: EglPrx[P]80
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   85
PWM (Da):   %s   8779.56  
PI (pH):   %s   9.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWKGCxxxxxISSKPGSKELAEKDAIDNKDLRAEGFETIAKTKSFVKNKRYHSHTKCPGIISCADILTIAAKDFVQPVLPSTYRP

Retrieve as FASTA  
Remarks Pseudogene sequence from NGS. 3' and PS are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAAGGGATGTGNNNNNNNNNNNNNGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCGAGACAATCGCG
AAAACCAAGTCCTTCGTGAAAAATAAG
GTGCTGCATGACAACATTTCTCATTCTCACAATTTTTGTTCTTTGGTTCCTCTGGAACAAAAAAAGAACAAAAACCCGTTTGGTAACGCCAAG
TTGTTTTTCTATTCCCTGGAATAGAAACGAAATAATTTCTAGAAATAAGCTACTTTTCTTTTTTCTTTTTCTTTTATTCCTCTCTCTTGCCGCGGCCACCTCCGACCGCTCAGAGCCACC
GCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGGCAATCCGTGAGCAAGAATAAAAAATAAATAAATACA
AAAGAGAAATTGTTGCGTTACCAAACGTTTACTTATAAATTGTTCCCCAAAATAGAAATAGAAAAGAACTATTTCTGAAAAAAAAAAAAAAAAAAAAAACTCTTCCCCAGCCAAGAAGCG
TTACCATTCACACACAAAATGCCCCGGCATCATTTCTTGTGCTGACATTCTCACCATCGCTGCCAAAGACTTTGTCCAACCGGTACTTCCATCAACCTATCGTCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAAGGGATGTGNNNNNNNNNNNNNGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCGAGACAATCGCG
AAAACCAAGTCCTTCGTGAAAAATAAG

Retrieve as FASTA