Entry information : EglPrx87
Entry ID 10909
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2016-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-15 (Achraf Jemmat)
Peroxidase information: EglPrx87
Name EglPrx87
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx87
start..stop
S start..stop
EgrPrx87 667 0 1..327 1..327
EguPrx83 655 0 1..327 1..327
EcamPrx87 653 0 1..327 1..327
EgrPrx83 642 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 626..842 217 N° 3 999..1152 154 N° 4 1274..1685 412
join(1..225,626..842,999..1152,1274..1685)


exon

Literature and cross-references EglPrx87
Protein sequence: EglPrx87
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   34992.03 (32065.4)  
PI (pH):   %s   8.09 (8.20) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSKLFLSCLLVQLTLLFLVPEVAHGQGLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTNQSEKNAGPNLSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGALSYDVETGRRDGNVSILTDALNNLIPPSANITTLKADFAKKGLSVKDLVALSGGHTIGTSHCSSFSDRVYNFTGKGDADPTLDSNYIARLKLRCKPNDQTTLVEMDPGSVRTFDVKYFDLIPKRRGLFTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCTKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTATTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AATGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCG
AGCTCACATGATTCTCGTCCTACCACAAGTGTAACTCGTCCTACTACGAGTGTAAAGTTTACCATTTTCTAATTACGTGATTCTTTGCATGTAACTAATGTTCGGATTCTAAGGTGAAAA
ACTTACTGGCGAAAAACGAGCGTGAGAATTTAGATCTTGGGCTTTCATCTGAAGGGGTAATGCATGGTAGGAATGCATAGAGATTTACAAAATTGATTTACTAGATAACAATATGATAAA
ATGGAAAATGTGTATTAGAACTAGTTATGTACTAGTAAATGGTGTTTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACGAACTACTGTCTTCATGAACTCACGGTTGAATCA
TCTTTTGTTCTGGGCCTCTCCACAGGGCTGCGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAATCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGA
TAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATCGTCTCATGTGCTGACATTTTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCGGTGAGCATATGCATACATTACCTCCTTTA
TT
GTTTGTTTTAAACTTGGATTTTTGTTATATAATTAGGACGTTAGTAGAAATCTTGATTTCACAAACGATATGTGTTATCTCATTTGAAATTTACGGCGCTCTTGACAAAACACGACTA
TTTTATATTTTAATGAGAAAAACATTCTTATACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCTTGACCGACGCACTTAACAATTTAATACCACC
TTCGGCCAACATTACAACTCTGAAAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGCCCT
GTCAGGTAACCCCTAATCTCCAATTATTGCTCCATATGCTTTGTCAAT
TATTTTATGGGGATTGACATAAATTAATCGGGAAGAAATTGTAATTCGAGTGCGATATCATAAACATCGTCAGCACTGGTGGGCACACCATTGGAACTTCACACTGCTCTTCCTTCTCCG
ACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGCAAGCCGAATGATCAAACCACCCTTGTCGAGATGGACC
CGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTTCTTGATGACAGCGAAACCAAGGCGTACATTGACCTCC
AGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGAACGGCGGGCGAAGTCAGAAAAGTGTGCACAAAGGTCA
ATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTATTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AATGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GGCTGCGAAGGTTCG
GTACTATTGAACTCTCCGACCAATCAATCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATC
GTCTCATGTGCTGACATTTTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCGGTGAGCATATGCATACATTACCTCCTTTATT
CACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGG
AACGTGTCTATCTTGACCGACGCACTTAACAATTTAATACCACCTTCGGCCAACATTACAACTCTGAAAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGCCCT
CACT
GGTGGGCACACCATTGGAACTTCACACTGCTCTTCCTTCTCCGACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTC
AGGTGCAAGCCGAATGATCAAACCACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCC
GCACTTCTTGATGACAGCGAAACCAAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTC
ACTGGAACGGCGGGCGAAGTCAGAAAAGTGTGCACAAAGGTCAATTGA

Retrieve as FASTA