Entry information : EglPrx[P]90
Entry ID 10911
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EglPrx[P]90
Name EglPrx[P]90
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]90
start..stop
S start..stop
EgrPrx[P]90 521 0 4..271 1..312
EguPrx[P]90 518 0 4..271 1..312
EcamPrx[P]89 308 5e-106 63..271 34..283
EglPrx[P]180 302 4e-105 86..273 2..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..258 258 N° 2 352..390 39 N° 3 503..664 162 N° 4 786..1184 399
join(1..258,352..390,503..664,786..1184)


exon

Literature and cross-references EglPrx[P]90
Protein sequence: EglPrx[P]90
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271
PWM (Da):   %s   28992.47  
PI (pH):   %s   8.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRLIFYHVGLHRL*MSYSILGDSSTSIQAALSVKLWSSRGSKRG*NKSSMACQQKMLMISRFEQGCDASLLLDDTEGFTGEKTAGGPTWTVQLGRRDSTTASLKDANSDVPLGIADLSDLISLFSKKGLSAKEMVALSGAGTHTIGQARCFVFRIRIYNEKNIDPAYAASLRQNCPSAGGDANLVPLEDGDVDGKVFNNDYFKNLVSMKGLLHSDQQLFNNGSTDADVKAYSLDSASFFADLANALVKMGNLSPLTGTDGQVRANCRKVNGS

Retrieve as FASTA  
Remarks Pseudogene from NGS. PS are missing due to NNNN. Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCGACTAATTTTTTATCATGTCGGTCTTCATAGATTATGAATGTCATATTCAATTCTAGGCGATTCTTCTACTTCCATCCAAGCTGCTTTATCTGTCAAACTTTGGTCTAGCAGA
GGGAGCAAACGAGGTTGAAACAAAAGCTCAATGGCTTGTCAACAAAAAATGCTAATGATATCGAGGTTTGAACAGGGTTGTGACGCGTCTCTATTGTTGGACGACACCGAAGGATTCACC
GGCGAGAAGACGGCAGGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGATGCCTT
TGCTACGTGTAGTCTTATATCCCTTTTTCG
ATCATTAAGACAGAAGGCGATTGTGTTCAGATCGATTATCCTAACCGGGGATCATGCAAAAAATTTCAGCTGGGGACCCACGTGGACCGT
ACAGTTAGGCAGGAGAGATTCAACCACGGCAAGTTTGAAAGATGCAAACAGCGATGTGCCTTTGGGAATCGCGGACCTTAGCGATCTCATATCTCTCTTCTCTAAGAAGGGCTTATCTGC
CAAAGAAATGGTCGCCCTCTCAGGTGTTTCATCTAAGAGAGAAGTGTCATTCTTTTGGTCTTTG
CACTTTGGAAAGGTTTTCTTTAATTGTCGTTGGGAGAAAATCGCCTGACCACGATC
CACCGTCGTATATGCGCTTTTGTACCGCAGGTACTCACACGATAGGCCAAGCGAGGTGCTTCGTGTTCCGCATTCGCATCTACAATGAGAAGAACATCGACCCCGCGTACGCCGCGTCGC
TGAGGCAGAACTGTCCCAGCGCAGGCGGGGATGCTAATCTCGTGCCGCTCGAGGATGGCGACGTCGACGGCAAAGTGTTCAACAACGACTACTTCAAGAACCTAGTGAGCATGAAGGGCC
TCCTGCACTCGGACCAGCAGCTGTTCAACAACGGATCCACTGACGCGGATGTGAAGGCCTACAGCCTCGACTCGGCATCCTTCTTCGCCGATCTGGCCAATGCCCTGGTGAAGATGGGGA
ACCTCAGCCCCCTCACGGGAACGGACGGGCAAGTTAGGGCCAATTGCAGGAAGGTTAATGGATCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCGACTAATTTTTTATCATGTCGGTCTTCATAGATTATGAATGTCATATTCAATTCTAGGCGATTCTTCTACTTCCATCCAAGCTGCTTTATCTGTCAAACTTTGGTCTAGCAGA
GGGAGCAAACGAGGTTGAAACAAAAGCTCAATGGCTTGTCAACAAAAAATGCTAATGATATCGAGGTTTGAACAGGGTTGTGACGCGTCTCTATTGTTGGACGACACCGAAGGATTCACC
GGCGAGAAGACGGCAGGN
AGATGCCTTTGCTACGTGTAGTCTTATATCCCTTTTTCGACCACGGCAAGTTTGAAAGATGCAAACAGCGATGTGCCTTTGGGAATCGCGGACCTTAGCGAT
CTCATATCTCTCTTCTCTAAGAAGGGCTTATCTGCCAAAGAAATGGTCGCCCTCTCAGGTGTTTCATCTAAGAGAGAAGTGTCATTCTTTTGGTCTTTG
TTCCGCATTCGCATCTACAAT
GAGAAGAACATCGACCCCGCGTACGCCGCGTCGCTGAGGCAGAACTGTCCCAGCGCAGGCGGGGATGCTAATCTCGTGCCGCTCGAGGATGGCGACGTCGACGGCAAAGTGTTCAACAAC
GACTACTTCAAGAACCTAGTGAGCATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTCAACAACGGATCCACTGACGCGGATGTGAAGGCCTACAGCCTCGACTCGGCATCCTTCTTC
GCCGATCTGGCCAATGCCCTGGTGAAGATGGGGAACCTCAGCCCCCTCACGGGAACGGACGGGCAAGTTAGGGCCAATTGCAGGAAGGTTAATGGATCT

Retrieve as FASTA