Entry information : EglPrx98
Entry ID 10919
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EglPrx98
Name EglPrx98
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx98
start..stop
S start..stop
EgrPrx98 706 0 1..349 1..349
EguPrx98 700 0 1..349 1..349
EcamPrx98 643 0 1..349 1..341
GhPrx05 416 6e-147 40..349 17..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..273 273 N° 2 1019..1201 183 N° 3 1362..1524 163 N° 4 1837..2264 428
join(1..273,1019..1201,1362..1524,1837..2264)


exon

Literature and cross-references EglPrx98
Protein sequence: EglPrx98
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349
PWM (Da):   %s   37452.13 Transmb domain:   %s   i12-34o
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLIMLRTKRRSSSSNVVATAIIAVLVPLVMHVMGSSESEGQEQQQLRVGFYSKSCPPAESIVHAVVKEAVLSVPRNAAVLLRxHFHDCFVEGCDGSILIDNGDISERHAGAHAGVGGFEIIEAAKARLESTCPGVVSCSDIVAMAARDAVFLSNGLFYEVQTGRRDGRVSNWTLAADMPDVNDSIHMLKAKFRQKGLKDKDLVLLSAAHTIGTTACFFMGTRLYQFNSTGGSDPAINPRFLPVLKSICPPGGDVNVRLALDATTEFVFDDLILHNIKNGFAVISSDARLYDSRHTRRIVDLYTQNGTSYKHEKPPSFKVDFAASMVKMGRIGVKxxxQGEIRRVCSSFN

Retrieve as FASTA  
Remarks Complete sequence from NGS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGATAATGCTGAGGACGAAGAGAAGGTCCAGCTCCAGCAATGTCGTCGCGACGGCCATTATCGCAGTTCTCGTCCCCCTCGTCATGCATGTTATGGGCTCGTCGGAATCGGAAGGA
CAAGAGCAGCAACAGCTTCGAGTCGGGTTTTACTCCAAAAGCTGTCCACCGGCTGAGTCCATCGTCCACGCCGTCGTCAAAGAGGCGGTCCTCTCGGTCCCTCGGAACGCCGCCGTCTTG
CTTCGGNTTCATTTCCACGACTGCTTCGTTGAG
GTGAATGATTTTGCCTTTTCCGCTTCCCTGAATAAACGTCTGTCTCTTTGCAATCAATGCGTCTTCATACACGACAGTTTTTAAATT
ATTAAATCGTGAGAAAAGTTTTTCAGTAAATGTTCATAATCTAGTACTTGTTAATTAACTTTCCTTACTGAAGAAGCAGGAAAATGCGGTCGAATTGTTGCTTTGGTAGACTAGTCTCAC
TAAAATGTCAAGATAACATCGTACAAATGACAAAACCAGAGCAAGGATATTTACACACAAAGGTGTTATGGTTTGTCGTGTAATTGATGGTGTTACATCTTGTACAATAAATTTCGTGGC
AAATAGTACCAAATGATCTAGTAAATATTTTTTACAGTTCCATCATGCGTGATCTTTGGTAAATAACCACCGATAGAAACCCTTGAAGTTACCCACTTTAATGGCTTCGGTGCATGATTT
TTGGGGATCGGGGATCGCTTTTGTGATATGCAAGGAGACAACATCATGGTCTGCTGAATAATTAAAAGGGCGGCACTGGAATTTCGTGGGACGACCTTCATTATTTTGGCTTGAGAACAG
CAAATGATCGGTCATAAGAAGGGACTAAATCGACCTTGAAAATCTTTTTTCCGTCAATGATTTTATCAGTGTTATTGCTCCTTCTCCACAGACCCAATAGGCAGTAATTTCTGCTGACGT
GGTAATTAATTTACACTAATTGTTGAGCAGTTTCTGATGACATATACATGTTAAACAGGGATGCGACGGGTCGATCCTGATCGACAATGGGGATATCAGCGAGCGGCACGCAGGGGCACA
TGCGGGTGTCGGAGGCTTTGAGATAATTGAAGCGGCCAAAGCTCGCTTGGAAAGCACTTGTCCTGGGGTCGTCTCTTGCTCCGATATCGTAGCTATGGCTGCTAGAGATGCTGTTTTCTT
G
GTAGATACTTTCCCCATCTTATACTCTTGCTGGCACAGATTTTGCTATCCAAATACCATTTGATAGCACTTTCCTTTAGAAGGAAAGTAAAAAGGGAGAGAAAGGTGTCAATTTTGATT
GCTCTGGTGGATTGAAGTTGTGTTGGCTTCATATGGTGCAGAGCAATGGCCTGTTCTATGAGGTGCAGACGGGGAGAAGAGATGGCCGCGTCTCAAACTGGACGCTCGCTGCAGATATGC
CGGATGTGAATGACTCGATTCATATGCTCAAGGCCAAGTTTAGACAGAAGGGGCTTAAAGATAAAGACCTCGTTCTTCTCTCCG
GTACGCCGCTCTTTACTAGTCAGCAGATGTGATTTA
TCAGCACAGCCGATTAATTACTCGGACAATACGTTAATATAGTCTAAAGTCTTAACAATTAGTAACATGACCATGTCAAGAAGAAGCAGGAATTTCCTCCTGAAACAACTACTCTTGCCT
TTAAGCTCCCCAAATGCATGTTCTAGAGCAGGAATTTGCTTCTGAAACAACTACTCTTGCCTTTTAGCTCCTCAGATGCATTTCTTTTTTCATCATTTGATATTCTAGAGCAGGAATTTC
CTTCTGAAACAACTACTCTTGGCTCTCCGTTTCTAGCTGCGCATACCATCGGAACAACCGCGTGTTTCTTCATGGGCACGCGGCTCTACCAATTCAATTCCACAGGCGGGTCAGACCCTG
CGATTAACCCTCGCTTCCTTCCGGTTCTCAAGTCCATATGCCCCCCCGGTGGGGATGTCAACGTGAGATTGGCTCTGGATGCCACCACTGAGTTCGTGTTCGATGATCTGATACTTCACA
ACATCAAGAACGGATTTGCCGTGATATCTTCGGACGCGAGGCTCTATGACAGCAGACACACCAGGCGGATAGTTGATCTGTATACTCAGAATGGGACTTCTTATAAGCACGAAAAACCAC
CGTCCTTCAAGGTGGATTTTGCAGCTTCGATGGTGAAGATGGGTCGGATTGGCGTGAAGNNNNNNNNNCAAGGAGAGATTAGGAGAGTTTGCAGCTCTTTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGATAATGCTGAGGACGAAGAGAAGGTCCAGCTCCAGCAATGTCGTCGCGACGGCCATTATCGCAGTTCTCGTCCCCCTCGTCATGCATGTTATGGGCTCGTCGGAATCGGAAGGA
CAAGAGCAGCAACAGCTTCGAGTCGGGTTTTACTCCAAAAGCTGTCCACCGGCTGAGTCCATCGTCCACGCCGTCGTCAAAGAGGCGGTCCTCTCGGTCCCTCGGAACGCCGCCGTCTTG
CTTCGGNTTCATTTCCACGACTGCTTCGTTGAG
GGATGCGACGGGTCGATCCTGATCGACAATGGGGATATCAGCGAGCGGCACGCAGGGGCACATGCGGGTGTCGGAGGCTTTGAGATA
ATTGAAGCGGCCAAAGCTCGCTTGGAAAGCACTTGTCCTGGGGTCGTCTCTTGCTCCGATATCGTAGCTATGGCTGCTAGAGATGCTGTTTTCTTG
AGCAATGGCCTGTTCTATGAGGTG
CAGACGGGGAGAAGAGATGGCCGCGTCTCAAACTGGACGCTCGCTGCAGATATGCCGGATGTGAATGACTCGATTCATATGCTCAAGGCCAAGTTTAGACAGAAGGGGCTTAAAGATAAA
GACCTCGTTCTTCTCTCCG
CTGCGCATACCATCGGAACAACCGCGTGTTTCTTCATGGGCACGCGGCTCTACCAATTCAATTCCACAGGCGGGTCAGACCCTGCGATTAACCCTCGCTTC
CTTCCGGTTCTCAAGTCCATATGCCCCCCCGGTGGGGATGTCAACGTGAGATTGGCTCTGGATGCCACCACTGAGTTCGTGTTCGATGATCTGATACTTCACAACATCAAGAACGGATTT
GCCGTGATATCTTCGGACGCGAGGCTCTATGACAGCAGACACACCAGGCGGATAGTTGATCTGTATACTCAGAATGGGACTTCTTATAAGCACGAAAAACCACCGTCCTTCAAGGTGGAT
TTTGCAGCTTCGATGGTGAAGATGGGTCGGATTGGCGTGAAGNNNNNNNNNCAAGGAGAGATTAGGAGAGTTTGCAGCTCTTTCAAT

Retrieve as FASTA