Entry information : EglPrx[P]101
Entry ID 10922
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EglPrx[P]101
Name EglPrx[P]101
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]101
start..stop
S start..stop
EguPrx[P]107 187 9e-63 1..102 28..169
EgrPrx[P]107 187 9e-63 1..102 28..169
EglPrx[P]107 186 1e-62 1..102 28..169
EcamPrx[P]108 157 1e-51 16..102 1..127
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..143 143 N° 2 233..308 76 N° 3 342..428 87  
join(1..143,233..308,342..428)


exon

Literature and cross-references EglPrx[P]101
Protein sequence: EglPrx[P]101
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   102
PWM (Da):   %s   11350.78 Transmb domain:   %s   o13-35i
PI (pH):   %s   8.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QNKTRSEGLDFEAIANSLNKWIVIFVLFVSFLVSLRNRKGSSADQHGRALGLQDDFYRHTCPATKEIVRSSMALLRLLFHDCFIRGCDASVLMDGSHGNRS

Retrieve as FASTA  
Remarks Pseudogene sequence from NGS. PS and a large 3' are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAAATAAAACAAGATCAGAAGGTTTGGACTTTGAAGCCATTGCCAACTCCCTGAACAAGTGGATCGTCATCTTCGTTCTCTTCGTCTCCTTCCTCGTCTCGCTCAGGAATCGCAAGGGC
TCAAGTGCAGATCAGCATGGACG
GCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCGCTCG
GGCTCCAGGACGACTTCTACCGCCACACGTGCCCTGCTACTAAAGAAATCGTGAGGTCATCCATGTCC
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGCTTCTCCGTCTCCTCT
TCCACGATTGCTTCATCAGGGGTTGCGATGCTTCAGTTCTCATGGACGGTAGCCATGGAAACCGAAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAAATAAAACAAGATCAGAAGGTTTGGACTTTGAAGCCATTGCCAACTCCCTGAACAAGTGGATCGTCATCTTCGTTCTCTTCGTCTCCTTCCTCGTCTCGCTCAGGAATCGCAAGGGC
TCAAGTGCAGATCAGCATGGACG
CGCGCTCGGGCTCCAGGACGACTTCTACCGCCACACGTGCCCTGCTACTAAAGAAATCGTGAGGTCATCCATGTCCGCGCTTCTCCGTCTCCTCTTC
CACGATTGCTTCATCAGGGGTTGCGATGCTTCAGTTCTCATGGACGGTAGCCATGGAAACCGAAGC

Retrieve as FASTA