Entry information : EglPrx109
Entry ID 10930
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EglPrx109
Name EglPrx109
Class Class III peroxidase     [Orthogroup: Prx021]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx109
start..stop
S start..stop
EgrPrx109 611 0 1..317 1..339
EcamPrx109 601 0 1..317 1..339
EguPrx109 592 0 1..317 1..339
EgrPrx105 584 0 1..317 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..237 237 N° 2 358..549 192 N° 3 701..866 166 N° 4 1020..1443 424
join(1..237,358..549,701..866,1020..1443)


exon

Literature and cross-references EglPrx109
Protein sequence: EglPrx109
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (288)
PWM (Da):   %s   34293.06 (31321.5) Transmb domain:   %s   i2-24o
PI (pH):   %s   4.53 (4.53) Peptide Signal:   %s   cut: 30 range:30-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALFYPGILTMQFLAAIAFISGILCSGASDPPLTLDYYASSCPNVLEIIHQEMEREVLSDPRNAALVLRLHFHDCFVQGCDGSVLLDDTVMLRGEKTASPNINSLKGFEIIDRIKSNVESECPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSRSASYELANTNIPTPNQGLIAIIYKFLYLGLSVTDTVALSGAHTIGVARCENFRARIYGDYELTSGGSPLSEVHLSQLKSTCPAAGGGDNNIAPLDYETPYTFDNSYYHLLLNGEGLLNSDQELYSSVFSVSMVKMGNLMNPDSFLNGEVRKSCRFINA

Retrieve as FASTA  
Remarks Partial sequence from NGS (3 introns) . 22 AA are missing in the exon 4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTATTTTATCCAGGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTTTATGTTCCGGTGCAAGCGACCCTCCACTGACGCTCGATTATTATGCA
TCCTCGTGCCCAAACGTGCTCGAAATAATCCACCAAGAAATGGAACGTGAGGTGCTCTCTGATCCGCGTAACGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GTG
CATTGCTTATATCGTAACTCTATGCAATTTTATATTCTGTTGTGTTTAATTGAACATGTACTTTGGGATGAAAGTATGCGTTAGTAGTGACAACCATCTTGAAGCATGGATCAATCTGGA
TGCGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGAGAGAAGACAGCTTCCCCAAATATAAACTCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAATGTTGAA
TCCGAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTATAGATTGTCCCTCTCTTTCTCTCTGAATTCCTCATTGGCATGTCAAAT
AATGTTCTGAATTATAACTTCTGTAGTTATTACTTGCTAACCAAGGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGATTCTCTTTCGTACTTGTTAGGTGGGCGGACCGTATTGGGA
TGTTCCGGTGGGGAGAAAAGACTCAAGAAGCGCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATCAAGGCCTCATTGCCATCATTTACAAGTTCCTTTACCTCGGCCTCTC
TGTCACCGACACCGTCGCACTTTCTG
GTAATTATTAAGTTTCTACTCCTCTTTAAGTGAGCGATCGAATTACTCACCCAAGGTGAGCTTATTGCCACAGAAGAAAGCGCGCTGATTAAGA
CTTGTATAGTACATTGCATGAGACTTTCCTTTTAACTATATGCACATGTGAATCGCTAGGGGCTCACACGATCGGCGTGGCACGCTGTGAGAACTTCCGTGCAAGAATATATGGGGACTA
CGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTGAGCCAATTGAAGTCCACATGCCCGGCCGCAGGAGGGGGAGATAACAACATCGCGCCTTTGGACTACGAAACGCCCTA
CACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTCAATTCTGACCAGGAACTATACTCAAGTGTATTCTCCGTTTCCATGGTAAAGATGGGGAACCTCATGAA
TCCGGATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTATTTTATCCAGGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTTTATGTTCCGGTGCAAGCGACCCTCCACTGACGCTCGATTATTATGCA
TCCTCGTGCCCAAACGTGCTCGAAATAATCCACCAAGAAATGGAACGTGAGGTGCTCTCTGATCCGCGTAACGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GGA
TGCGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGAGAGAAGACAGCTTCCCCAAATATAAACTCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAATGTTGAA
TCCGAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCAAGAAGC
GCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATCAAGGCCTCATTGCCATCATTTACAAGTTCCTTTACCTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCTG
GGGCT
CACACGATCGGCGTGGCACGCTGTGAGAACTTCCGTGCAAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTGAGCCAATTGAAGTCCACATGC
CCGGCCGCAGGAGGGGGAGATAACAACATCGCGCCTTTGGACTACGAAACGCCCTACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTCAATTCTGACCAG
GAACTATACTCAAGTGTATTCTCCGTTTCCATGGTAAAGATGGGGAACCTCATGAATCCGGATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCATGA

Retrieve as FASTA