Entry information : EglPrx112
Entry ID 10933
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2016-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-13 (Achraf Jemmat)
Peroxidase information: EglPrx112
Name EglPrx112
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx112
start..stop
S start..stop
EgrPrx112 640 0 1..319 1..319
EguPrx112 637 0 1..319 1..319
EcamPrx112 631 0 1..319 1..319
EglPrx113 626 0 1..319 14..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 343..534 192 N° 3 690..852 163 N° 4 1002..1393 392
join(1..219,343..534,690..852,1002..1393)


exon

Literature and cross-references EglPrx112
Protein sequence: EglPrx112
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (296)
PWM (Da):   %s   34135.68 (31639.3) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.73 (9.87) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATHDIVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRRDSITASRSLANTLPSPASNLSALITSFAAKGLSVKNMVALSANIDTSFAHKLQKTCPKIGNDSVLQRLDIQTPTFFDNLXXXNLLQKKGLLHSDQELFNGSSVDSLVKKYACDTEKFFRDFVRAMIKMSEIKPPKGSNGQIRKNCRKVNQV

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACGATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACAGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTTGTCAAT
GTGATTCGCGTCTTCTAGAGA
TTCCTTGCGAAACGATCCCACTTTGATTCATTAGCCTTCCAGAGTTTTCCTCTTCTTTTCCTTCCTCCTCAATATTGATGTGTGTATCTACGAATTGGTCAGGGGTGCGATGCGTCGATA
TTGTTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGA
GTGGTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAAT
TTAGTACATTTTTGCCTCGACGGTTATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCTCGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAG
GGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGG
TGGCTCTTTCTG
GAAAAGAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAATGTCGATGTACTTTATCAGCTGACAGTGGTTTTCAAATTGACAGGTTCACATACCATTGGCCT
AGCGAGATGCAGTTCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCT
AGACATCCAAACGCCGACCTTCTTTGACAACCTTNNNNNNNNNAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAA
GAAGTATGCATGCGACACAGAAAAATTTTTCCGAGACTTTGTTAGGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGT
CAACCAAGTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACGATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACAGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTTGTCAAT
GGGTGCGATGCGTCGATATTG
TTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTG
GTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCT
AACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
CGAACATAGATACATCCTTCGCCCAT
AAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTNNNNNNNNNAATTTACTGCAGAAGAAGGGCCTT
CTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACAGAAAAATTTTTCCGAGACTTTGTTAGGGCAATGATCAAAATGAGCGAA
ATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTCAACCAAGTATGA

Retrieve as FASTA