Entry information : EglPrx113 (Px2)
Entry ID 10934
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2012-08-22 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-24 (Christophe Dunand)
Peroxidase information: EglPrx113 (Px2)
Name (synonym) EglPrx113 (Px2)
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx113
start..stop
S start..stop
EcamPrx113 641 0 19..333 1..315
EgrPrx113 638 0 19..333 1..315
EguPrx113 637 0 19..333 1..315
EguPrx112 626 0 14..333 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..258 258 N° 2 382..573 192 N° 3 735..900 166 N° 4 1049..1434 386
join(1..258,382..573,735..900,1049..1434)


exon

Literature and cross-references EglPrx113 (Px2)
Literature Vatulescu,A.D., Vieira-da-Silva,S.M. and Jackson,P.A. Direct Submission. Submitted (24-JAN-2006) Plant Cell Wall Group, Instituto de Tecnologia Quimica e Tecnologica, Av. da Republica, Oeiras 2781-901, Portugal.
Ancient polymorphisms in wood formation genes highlight balancing selection of universal importance for adaptation across the Eucalyptus genus. Sexton,T.R., Henry,R.J., McManus,L.J., Thomas,D., Nock,C.J., Brooks,L. and Shepherd,M., unpublished.
Protein ref. GenPept:   BAM05637.1 UniProtKB:   Q27U88
DNA ref. GenBank:   AB591335.1
mRNA ref. GenBank:   DQ376125
Protein sequence: EglPrx113 (Px2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333
PWM (Da):   %s   35918.65 Transmb domain:   %s   i13-35o
PI (pH):   %s   9.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLVFNRNISIIHVMATHDIVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRRDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFRGRIYNDSNIDTSFAHKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKVN

Retrieve as FASTA  
Remarks Sequence derived from a reference alignment of Illumina GAIIx reads (AB591335.1). This is a consensus sequence representing a pool of 30 individuals collected from the geographical range of the species. Probably related to cell wall modification. Sub_species="globulus".
Note : in AB591335.1, first codon is TTG, but translated as M in the related protein BAM05637.1
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGTTTTCAACAGGAACATATCGATAATTCATGTCATGGCTACACACGATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAG
CTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACGGGCGCGTCCTTGCTTCGGCTGCACTTC
CATGACTGCTTTGTCAAT
GTGATTCGCGTCTTCTAGAGATTCCTTGCGAAACGATCCCACTTTGATTCATTAGCCTTCCAGAGTTTTCCTCTTCTTTTCCTTCCTCCTCAATATTGATGT
GTGTATCTACGAATTGGTCAGGGGTGCGATGCGTCGATATTGTTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATC
GACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAG
TCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAATTTAGTACATTTTTGCCTCGACGGTTATAATCGGACAAATCTANNNTNTTTTTTCCTGATTTCTTCTATGTTTTCTCTTGTG
TGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCTCCACCTACTTCTAATCTCAGTG
CTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTAATTTCAACTCAATATTATCACCTTGCACCGCGCATTACAACCAAGAATATTCAAAAG
AAAAGAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAACGTCGATGTACTTTATCAGCTGACAGCGGTTTTCAAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCACT
TCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGATATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACG
CCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGC
GACACAGGAAAATTTTTCCGAGATTTTGCCAAGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGTTTTCAACAGGAACATATCGATAATTCATGTCATGGCTACACACGATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAG
CTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACGGGCGCGTCCTTGCTTCGGCTGCACTTC
CATGACTGCTTTGTCAAT
GGGTGCGATGCGTCGATATTGTTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGAC
CGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTA
GGGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCTCCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAAC
ATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGATATGT
CCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAG
CTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACAGGAAAATTTTTCCGAGATTTTGCCAAGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGA
AGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTCAACTAA

Retrieve as FASTA