Entry information : EglPrx117
Entry ID 10937
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2016-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-13 (Achraf Jemmat)
Peroxidase information: EglPrx117
Name EglPrx117
Class Class III peroxidase    [Orthogroup: Prx213]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx117
start..stop
S start..stop
EgrPrx117 622 0 14..325 14..326
EguPrx117 619 0 14..325 14..326
EcamPrx114 468 8e-168 8..325 5..322
EgrPrx114 466 3e-167 8..325 5..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..231 231 N° 2 607..802 196 N° 3 900..1058 159 N° 4 1156..1547 392
join(1..231,607..802,900..1058,1156..1547)


exon

Literature and cross-references EglPrx117
Protein sequence: EglPrx117
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (295)
PWM (Da):   %s   35193.93 (32175.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.66 (7.31) Peptide Signal:   %s   cut: 31 range:31-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTASSSFSKAVLSFACVLVLISASTSAQLSLDYYSRSCPVLFPTVRLIVGAAIAREARMGASLLRLFFHDCFVNGCDGSLLLDDTPTFTGEKNAAPNVNSVRGFEVVDQVKSAVEGVCPGIVSCADLLAIIARDSVVIVRPWWPVKLGRRDARSASQAAANESIPRPTSDLNELISSFRNVGLNIRDLVALAGGHTIGLSRCTNFRDRVYNETDIDVLLAQTRKFGCPGIDGVDDDNLAPLDFQTPITFDHSYYSNLVQRRGLLHSDQQLFNGxPTDSFVRLYSRSPLAFQGDFVASITRMGDIKPLTGSNGEIRRNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCAACCGCTAGTTCTTCGTTTTCAAAGGCCGTTTTGAGTTTCGCTTGCGTTTTGGTCTTGATCAGTGCAAGCACGAGCGCGCAGCTTTCCCTCGACTATTATTCCAGATCT
TGCCCCGTCCTCTTCCCCACGGTGAGGCTGATCGTGGGAGCCGCTATAGCGAGGGAGGCTCGGATGGGCGCCTCACTGCTTCGCCTGTTCTTCCATGATTGCTTCGTCAAT
CTAACTCTG
CACTCATCGCGCTCGTATGTGCAACCAGCATCATGCGATAGAGTTTATAACCAGTTCGCTTGGGGTAATTCTTTTCATGATCCAATACTATGCAATGTGTTCACAGTTACTCAAATGGTT
GTTCGTCGTTCAAAGTAGCAAGAGCTCAACATCTAGTCCATTGTCCCAAGGTCATAAGGAATTGAATATGAAAGCCTGAACTACTATTAATCTTAATGTAGCGCCTTTTAGCAAACATAC
TGCGAACCTATAGCTGACGGAATACGTATTACTGTTGAAACGCATTTGATATCGGCGTTGTATCAGGGCTGCGACGGATCGCTTCTTCTGGATGATACACCTACCTTCACTGGAGAGAAA
AACGCCGCTCCAAATGTCAATTCAGTGCGAGGGTTCGAAGTGGTCGACCAAGTTAAGTCCGCCGTGGAGGGGGTGTGTCCAGGCATTGTCTCGTGCGCCGATCTGTTGGCGATTATCGCG
CGAGACTCCGTCGTGATCGTGAGCTGTTTGAATTTGGCTAGCAATTAATATACAATTAATAGAGATTTGGCGATGTTCTAAT
GGCCATGGTGGCCAGTGAAGCTGGGAAGAAGAGATGCT
AGAAGCGCAAGCCAAGCAGCTGCTAATGAGAGCATCCCCCGGCCGACGTCCGACCTCAACGAATTAATCTCCTCGTTCCGAAATGTCGGTCTCAACATCAGGGACCTCGTGGCTTTAGCA
GGTAACTAAAATTGGAATTTATCTCGCATAATCGAATCAGAAAGATGAGATCGAGAGCTCGTTCAATTTGATACATATTTTTTTCGCGCCATTTCAAG
GAGGCCACACGATCGGACTATC
AAGATGCACGAACTTCAGGGACCGGGTCTACAACGAGACCGACATCGACGTGCTGTTGGCCCAAACGAGGAAGTTCGGCTGCCCTGGCATCGACGGCGTGGACGACGACAATCTGGCCCC
GCTCGACTTCCAGACCCCGATAACGTTCGACCACAGCTACTACTCCAACCTCGTCCAGAGGCGCGGCCTTCTCCACTCGGACCAGCAGCTCTTCAACGGNNGGCCCACCGACTCGTTCGT
GAGGCTCTATAGCAGAAGCCCGCTCGCCTTCCAGGGGGACTTCGTGGCCTCCATCACGAGGATGGGCGACATCAAGCCCCTCACCGGATCCAACGGTGAGATTCGGAGGAACTGCAGGAG
GGTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCAACCGCTAGTTCTTCGTTTTCAAAGGCCGTTTTGAGTTTCGCTTGCGTTTTGGTCTTGATCAGTGCAAGCACGAGCGCGCAGCTTTCCCTCGACTATTATTCCAGATCT
TGCCCCGTCCTCTTCCCCACGGTGAGGCTGATCGTGGGAGCCGCTATAGCGAGGGAGGCTCGGATGGGCGCCTCACTGCTTCGCCTGTTCTTCCATGATTGCTTCGTCAAT
GCTCCAAAT
GTCAATTCAGTGCGAGGGTTCGAAGTGGTCGACCAAGTTAAGTCCGCCGTGGAGGGGGTGTGTCCAGGCATTGTCTCGTGCGCCGATCTGTTGGCGATTATCGCGCGAGACTCCGTCGTG
ATCGTGAGCTGTTTGAATTTGGCTAGCAATTAATATACAATTAATAGAGATTTGGCGATGTTCTAAT
CGAATTAATCTCCTCGTTCCGAAATGTCGGTCTCAACATCAGGGACCTCGTGG
CTTTAGCAGGTAACTAAAATTGGAATTTATCTCGCATAATCGAATCAGAAAGATGAGATCGAGAGCTCGTTCAATTTGATACATATTTTTTTCGCGCCATTTCAAG
CGGCTGCCCTGGCA
TCGACGGCGTGGACGACGACAATCTGGCCCCGCTCGACTTCCAGACCCCGATAACGTTCGACCACAGCTACTACTCCAACCTCGTCCAGAGGCGCGGCCTTCTCCACTCGGACCAGCAGC
TCTTCAACGGNNGGCCCACCGACTCGTTCGTGAGGCTCTATAGCAGAAGCCCGCTCGCCTTCCAGGGGGACTTCGTGGCCTCCATCACGAGGATGGGCGACATCAAGCCCCTCACCGGAT
CCAACGGTGAGATTCGGAGGAACTGCAGGAGGGTTAATTGA

Retrieve as FASTA