Entry information : EglPrx118
Entry ID 10938
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2012-05-14 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-13 (Christophe Dunand)
Peroxidase information: EglPrx118
Name EglPrx118
Class Class III peroxidase    [Orthogroup: Prx083]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx118
start..stop
S start..stop
EgrPrx118 699 0 1..339 1..339
EguPrx118 682 0 1..339 1..339
EcamPrx119 615 0 1..339 1..338
EgrPrx119 613 0 1..339 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..246 246 N° 2 732..1505 774  
join(1..246,732..1505)


exon

Literature and cross-references EglPrx118
Protein sequence: EglPrx118
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (313)
PWM (Da):   %s   36403.64 (33712.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.37 (9.51) Peptide Signal:   %s   cut: 27 range:27-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADSMFWGIAWAFVLVLAGTVPSVAAATKPCRTSSKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTPENPAERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIYYNVPAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHCSSFSSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKYYLQLLKLRGVLATDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGEIRELCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCGATGTTCTGGGGTATCGCATGGGCTTTCGTCCTAGTTTTGGCCGGCACCGTCCCATCTGTGGCGGCGGCTACGAAGCCATGCCGGACATCGTCCAAGTTCAGGGTCGGA
TTCTACAAGTACACCTGTCCAGCTGCGGCGTCGATCGTCAAGCAGACTGTGTATGAAGCCGTCGCCAAGAATCCCGGAATGGCGGCCGGACTCCTCCGCCTGCATTTCCACGATTGCTTT
GTTAGG
GTACATGAAACATCTCTAGCTCCTTTTGACGAGTCCTTTAATTTATAGGCTCGTTTCACTATACAAATACGCGTGCCTGGCCGTGCGCATACGTACTTCAAGACACATGATACT
TGGTCAATCCCTATCCATCAGAAATTACAATATTAGTCAACACCTCAGGGTTGACACAATTGCTTGGAGGGGAAGGTATTTTCATGTCGGCAACTGAAGATCGCCTATTCAAATCCCATA
ACTTACGTACTAACTGCACCGGGTCATCTGTATAGGCCAAAGATTGGACTTTAACAGGTTTGTTGGGGGTTGTAGGGTATTCCCCGGGCTTCAAAGGCAGCAAGGCCTCTAAACTCATGC
CCTTAGTTTATAAAATGAAATTTACATAATCAAACACAAAATTTAGTTAAGTAAATTTAACAGAGTTCGAAAAATAAAACGAATTTGGTATGGCATGTTGTTTCTATCTCTAACCATTGA
ATTTTGATTAGGGTTGCGATGCTTCGGTGCTCTTGAAATCGACCCCTGAAAACCCGGCGGAGAGAGACCATCCCACCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGACCAGGCCA
AGGCCAGACTCGAGGCCGTGTGTCCCAAAACGGTCTCGTGCGCCGACATCGTTGCTTTCGCGGCCCGCGACAGCGTCTACAAAACCGGGGGCATATATTACAACGTCCCTGCTGGCCGCC
GTGATGGCCGCGTCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGTCGCCAAACTTCAACGCCCAACAGTTGATTGCTAATTTCGCCAGGAAAGGCCTGTCGGCGAACGAGATGGTGA
CCCTCTTGGGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCGTCCCGGCTCTACGCGTTCAATGCCACACTGACCCAAGATCCTTCGTTGGATCCGGCATTCGCCGCCTTCC
TGAAGACCAAATGCCTACCCCAAAGCAACGTGACACGAGTAGACCCGACGGTGCCGCTCGACAGCATCACACCTGGCACTCTGGACAACAAGTACTACCTTCAGCTGCTGAAGCTCCGCG
GCGTGTTGGCTACGGACGAGACACTGTACACAAGTCCCTCAACTTCGCGGATGGTTGTGAGCAACGCGGTGAATGGCGCCGCTTGGAGAGCGAAGTTCGCCAAGGCAATGGTGAAGATGG
GCTCGCTCGACGTGCTCACCGGCGCACAGGGAGAGATCAGGGAGCTGTGCAGTGTAGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCGATGTTCTGGGGTATCGCATGGGCTTTCGTCCTAGTTTTGGCCGGCACCGTCCCATCTGTGGCGGCGGCTACGAAGCCATGCCGGACATCGTCCAAGTTCAGGGTCGGA
TTCTACAAGTACACCTGTCCAGCTGCGGCGTCGATCGTCAAGCAGACTGTGTATGAAGCCGTCGCCAAGAATCCCGGAATGGCGGCCGGACTCCTCCGCCTGCATTTCCACGATTGCTTT
GTTAGG
GGTTGCGATGCTTCGGTGCTCTTGAAATCGACCCCTGAAAACCCGGCGGAGAGAGACCATCCCACCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGACCAGGCCAAGGCC
AGACTCGAGGCCGTGTGTCCCAAAACGGTCTCGTGCGCCGACATCGTTGCTTTCGCGGCCCGCGACAGCGTCTACAAAACCGGGGGCATATATTACAACGTCCCTGCTGGCCGCCGTGAT
GGCCGCGTCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGTCGCCAAACTTCAACGCCCAACAGTTGATTGCTAATTTCGCCAGGAAAGGCCTGTCGGCGAACGAGATGGTGACCCTC
TTGGGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCGTCCCGGCTCTACGCGTTCAATGCCACACTGACCCAAGATCCTTCGTTGGATCCGGCATTCGCCGCCTTCCTGAAG
ACCAAATGCCTACCCCAAAGCAACGTGACACGAGTAGACCCGACGGTGCCGCTCGACAGCATCACACCTGGCACTCTGGACAACAAGTACTACCTTCAGCTGCTGAAGCTCCGCGGCGTG
TTGGCTACGGACGAGACACTGTACACAAGTCCCTCAACTTCGCGGATGGTTGTGAGCAACGCGGTGAATGGCGCCGCTTGGAGAGCGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCG
CTCGACGTGCTCACCGGCGCACAGGGAGAGATCAGGGAGCTGTGCAGTGTAGTGAACTGA

Retrieve as FASTA