Entry information : EglPrx120
Entry ID 10940
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2012-05-14 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EglPrx120
Name EglPrx120
Class Class III peroxidase    [Orthogroup: Prx187]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx120
start..stop
S start..stop
EgrPrx120 692 0 1..335 1..335
EcamPrx120 687 0 1..335 1..335
EguPrx120 643 0 1..335 1..335
EcamPrx119 454 1e-161 5..335 7..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..240 240 N° 2 1477..2244 768  
join(1..240,1477..2244)


exon

Literature and cross-references EglPrx120
Protein sequence: EglPrx120
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (314)
PWM (Da):   %s   36325.42 (34200.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.98 (8.98) Peptide Signal:   %s   cut: 22 range:22-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIQALVASFFLVFAVSATALPTQVYPLSSPSSLSVGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTAEKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGRRDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRLYSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGLFSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIRKVCGAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTACGCAGGTGTACCCGTTATCTTCGCCGTCGTCCCTCAGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GTAATATGCTCTATATGAACATCAAATGAAGGATTTTGCGCTTATTCGTCATTCATTTTCTTGATTTTCCAATAATGTGTTGATGCAGACTCAAATATCAGTTAAAATACAAAGTTGCCA
TGTTAACACCGACACCAAGATACTCTAGAAACGATATGGTACCTTAAATGGGAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTCAGTCTTAATTTTTTTTTCTTTT
GCCAATTCAATCATGACGTGGACAATTTTAATAATATTTTAATTTTTTCGAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCTAGGCGAGACCA
ACCTCGCCATGTCCTTCCTAGCCATGGGTGAAGGTGGCCTTGCCCACATCTAGGTGAAGCTGCCTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGAAATGCATCAAAACATATGTATTTTTAGTGTTGTGTAGTGTAAAATTGCACCTTTCCCTGGTTGCTATTT
CTTACAGTGGAATGGATATAAAGAATGATTTCTCAATGCACATGCCGAGGCAGCAACTTATCACTAAGTTGTGCTTTGGCTGCATACCTTCCTTACTTTAGCAAAGCTAGGTTTACGAAG
ATCAGTATACAAAATTCGTATATCGTGCCAGAAAGTAGAAGGATTCCATAAGTGAAAATTGAAACAAGCGGGTAATAATCATATCTAATTTGAGTCTATCACATCATCTAGTATATCATA
TTATCTGATTTGTTAGCTCTTCCCCATTGATTTTAGGGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAA
GGTTTCGATGTCATCGACCAAGCGAAAGCCCGGCTAGAAGCCGCATGCCCGCGAACTGTCTCATGCGCCGACATCATCGCATTTGCAGCCCGAGACAGCGTCTTCAAGGCTGGCCGTATC
TACTATGATGTCCCCTCGGGCCGTCGTGATGGTCGCATCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACTGTGCCGCAACTCATTGCCAACTTCGCGAGAAAA
GGGTTCTCAATGGACGAGATGGTGACCCTCTCGGGAGCACACTCCATCGGCAGCTCTCACTGCTCGTCCTTCTCGAACCGTCTGTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTG
TTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAGTGCCCCCAGGGCAATTCCAAGACGGACCCGAAGGTGGCGCTCGACAGCATCACGCCAAACACTCTGGACAACAAGTACTACCAA
CAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGATGAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGCCGCGTGTGGGGGCCTAAGTTCGTG
AAGGCAATGGTGAAGCTGGGCTCGCTCGACGTGCTCACTGGTCAACAGGGCGAAATTAGGAAAGTTTGCGGCGCCGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTACGCAGGTGTACCCGTTATCTTCGCCGTCGTCCCTCAGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAAGGTTTCGATGTCATCGACCAAGCGAAAGCCCGGCTA
GAAGCCGCATGCCCGCGAACTGTCTCATGCGCCGACATCATCGCATTTGCAGCCCGAGACAGCGTCTTCAAGGCTGGCCGTATCTACTATGATGTCCCCTCGGGCCGTCGTGATGGTCGC
ATCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACTGTGCCGCAACTCATTGCCAACTTCGCGAGAAAAGGGTTCTCAATGGACGAGATGGTGACCCTCTCGGGA
GCACACTCCATCGGCAGCTCTCACTGCTCGTCCTTCTCGAACCGTCTGTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTGTTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAG
TGCCCCCAGGGCAATTCCAAGACGGACCCGAAGGTGGCGCTCGACAGCATCACGCCAAACACTCTGGACAACAAGTACTACCAACAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGAT
GAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGCCGCGTGTGGGGGCCTAAGTTCGTGAAGGCAATGGTGAAGCTGGGCTCGCTCGACGTGCTC
ACTGGTCAACAGGGCGAAATTAGGAAAGTTTGCGGCGCCGTGAATTGA

Retrieve as FASTA