Entry information : EglPrx122
Entry ID 10942
Creation 2012-05-14 (Qiang Li)
Last sequence changes 2016-02-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-15 (Achraf Jemmat)
Peroxidase information: EglPrx122
Name EglPrx122
Class Class III peroxidase    [Orthogroup: Prx191]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx122
start..stop
S start..stop
EgrPrx122 617 0 1..315 1..316
EguPrx122 609 0 1..315 1..309
EcamPrx122 585 0 1..315 22..337
EgrPrx121 491 7e-177 6..315 31..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..153 153 N° 2 449..1243 795  
join(1..153,449..1243)


exon

Literature and cross-references EglPrx122
Protein sequence: EglPrx122
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316
PWM (Da):   %s   33044.81  
PI (pH):   %s   9.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPPLKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGNPAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFTGGIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSIGISHCSSFSSRLYAFNATHAQDPTLDRTYATFLKTKCPPPSNKTQPDPTVPLxxITANTLDNKYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNARNGYTWSWKFAKxMVKMGSIEVLAGxxxxxxxCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from NGS (short 3 'end is missing due to "n" in the sequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCCCCCACTAAAGGTGGGATACTACCTCCGTACTTGCCCGTTGGCAGAAAATATCATCAAGCAAACCGTGTTCAACGCTGTCTCGAGGAACCCTGGGATGGCGGCCGGTCTT
GTTCGCCTGCATTTTCACGACTGCTTCGTTAGG
GTACGGTGAAGTATTTATGCTCAAAAGTTTTCCCTTAATCGACTTATTTCGCTTTCTTTAAATATTAATTTCTTCCCTTTTGAGTAA
TTCCCTTTGCTTTATACTTGAAATGATTGGAAGGAAAATGTTGAAAGTGTGCTAGAGAATTTGCTAAGACTCTTAAAATATGTATTGGAAATGTAAATTTTTATTATGAGGCATATAGTT
TCTTTTGTATCGTGTGTGTGCTCGTGTGTATGGTTGATAGTTATTTTGTGATTTCTATACTCTTACTGACTTTCTAGACTTATCTCAGGGCTGTGATGCTTCAGTGCTCTTGAAATCAAC
CCCAGGAAACCCGGCGGAAAGAGATCACCCCGCTAACAACCCTAGCCTCCGAGGGTTTGAAATCATCGACCAGGCCAAGGCCCGGCTCGAAGCCTTGTGCCCTGGGACAGTCTCGTGTGC
CGACATCGTCGCCTTTGCTGCCCGTGACAGTGCCCAATTTGCCAGCCGCAACAGTGCCCTATTCACTGGGGGCATAATCTACGACGTCCCTGCTGGCCGCCGCGACGGCCGTGTCTCTCG
CCTCCCGGAAGTCACACAGAACCTCCCGCCGCCGAGCTTCAACGCCCAGCAGCTCATTGCCAACTTCGCTAGGAAAGGGCTCTCGGTGGATGAGATGGTGACCCTCTCGGGAGCGCACTC
GATCGGAATCTCGCACTGCTCTTCGTTCTCGAGCCGCCTCTACGCGTTCAACGCCACCCACGCCCAAGATCCTACCTTGGACCGTACGTACGCCACTTTCCTGAAGACCAAGTGCCCGCC
ACCGAGCAACAAGACCCAACCGGACCCAACCGTGCCGCTGATNANCATCACAGCCAACACTCTGGACAACAAGTACTACATTCAGTTGCTGCAGCGCCGCGGCTTGTTGACTTCCGACGA
GACGCTGTACACGAGTCCCTCGACTTCGGGGCTGGTCGTGAACAACGCGAGGAATGGCTATACTTGGAGCTGGAAGTTCGCCAAGCANATGGTGAAGATGGGCTCGATCGAAGTGCTCGC
TGGNNNNNNNNNNNNNNNNNNNNTGTGCAGTGTCGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCCCCCACTAAAGGTGGGATACTACCTCCGTACTTGCCCGTTGGCAGAAAATATCATCAAGCAAACCGTGTTCAACGCTGTCTCGAGGAACCCTGGGATGGCGGCCGGTCTT
GTTCGCCTGCATTTTCACGACTGCTTCGTTAGG
GGCTGTGATGCTTCAGTGCTCTTGAAATCAACCCCAGGAAACCCGGCGGAAAGAGATCACCCCGCTAACAACCCTAGCCTCCGAGGG
TTTGAAATCATCGACCAGGCCAAGGCCCGGCTCGAAGCCTTGTGCCCTGGGACAGTCTCGTGTGCCGACATCGTCGCCTTTGCTGCCCGTGACAGTGCCCAATTTGCCAGCCGCAACAGT
GCCCTATTCACTGGGGGCATAATCTACGACGTCCCTGCTGGCCGCCGCGACGGCCGTGTCTCTCGCCTCCCGGAAGTCACACAGAACCTCCCGCCGCCGAGCTTCAACGCCCAGCAGCTC
ATTGCCAACTTCGCTAGGAAAGGGCTCTCGGTGGATGAGATGGTGACCCTCTCGGGAGCGCACTCGATCGGAATCTCGCACTGCTCTTCGTTCTCGAGCCGCCTCTACGCGTTCAACGCC
ACCCACGCCCAAGATCCTACCTTGGACCGTACGTACGCCACTTTCCTGAAGACCAAGTGCCCGCCACCGAGCAACAAGACCCAACCGGACCCAACCGTGCCGCTGATNANCATCACAGCC
AACACTCTGGACAACAAGTACTACATTCAGTTGCTGCAGCGCCGCGGCTTGTTGACTTCCGACGAGACGCTGTACACGAGTCCCTCGACTTCGGGGCTGGTCGTGAACAACGCGAGGAAT
GGCTATACTTGGAGCTGGAAGTTCGCCAAGCANATGGTGAAGATGGGCTCGATCGAAGTGCTCGCTGGNNNNNNNNNNNNNNNNNNNNTGTGCAGTGTCGTGAACTAA

Retrieve as FASTA