Entry information : EglPrx126
Entry ID 10946
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2012-05-15 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-15 (Christophe Dunand)
Peroxidase information: EglPrx126
Name EglPrx126
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx126
start..stop
S start..stop
EgrPrx126 675 0 1..328 1..328
EguPrx126 668 0 1..328 1..328
EcamPrx126 577 0 47..328 1..282
EgrPrx125 562 0 1..328 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 615..806 192 N° 3 910..1075 166 N° 4 1250..1659 410
join(1..219,615..806,910..1075,1250..1659)


exon

Literature and cross-references EglPrx126
Protein sequence: EglPrx126
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   35215.83 (32983.6)  
PI (pH):   %s   7.42 (7.06) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAGKGHLVLSLTLLLVLACNADDDGGLRKNFYKKSCPQAEKLVRDITWSKAQADPTLGAKLLRVHYHDCFVRGCDGSVLLDPVGTNQSEKNAVPNLTLAGFDVIDDIKKQVEQACPNTVSCADVLSLAARDAVSFPFKKPIWDVLMGRRDGNISLASNIPGNLPSPFADFSTLAQIFSKKGLNVNDLVVLSGAHTIGVAHCGTFSRRLYNFTGKGDADPSLNATYAASLRTQCPNSANPATTVEMDPQSSLSFDSHYFDILIENEGLFQSDAALLTNQGAAKVVQHLRSPDAFFSEFGKSMKKMGAIEVLTGTAGEIRKQCRVVNQS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCTGGGAAAGGTCATTTGGTTTTGTCACTGACTCTTCTCTTGGTCCTAGCGTGTAATGCAGATGATGATGGTGGATTGAGGAAGAACTTCTACAAGAAGAGTTGCCCTCAAGCT
GAGAAGCTTGTGAGGGACATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGG
GTAACAAATTCCTATATATCC
CCAAAGTAGATTCCCTGATCGAAACATGTGAAGAGTAACTACTATCTACAATAAAAGTTGCCGACCTTTCTTCTTTATAGTGTGTGACTTGAGATTCCTGTCAACCTATCTAAAAGTTTA
AGTCATTATTATGCCAATAATCATCGTTGCTTGTTGAGACAGTAGGCAGGGAATATAGGGAACATATCTCAACCGTTCTGCATGGTTCATGCTTCACATCATATACGTTTGAACTTAGCG
AGCTCAACTCTCCATGTGATGAGTTAGGGCTTAAGACGTATGACTTTGCATTTGACATTATTAGAGAAATAGTTGCATCTAATGTCTCTCAATCACACCAAGGTTGACGAAATTCTGGAA
TAATTCATTTTTAGGGATGTGATGGATCCGTACTGCTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCA
AGAAACAAGTTGAGCAAGCTTGCCCCAACACTGTCTCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
GTAAGAAAACCTGCCTAATTGATTGTCTAAAATC
ATTAATTTCTTCGCTGAAAATGGTCAAAATATAAGGTTTGTCATTTGAATATGATGGCGTAAATTGCAGTTTAAGAAGCCGATTTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATT
TCGTTAGCATCCAACATCCCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTACTCTTGCACAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTAAG
CCGACGTGATCATGTCCTTTTTCGGATGGTTGAATTAAGATTTCCACACTTACATTTGGATCTTCAAATTAACATCGAAGCTAATTAAAGTACAAAACTGACATACTGCATTGAGTTAGA
CATTTCACAATGTACAATGAAATCATCTATATCTTTGCTCCTTCACCAGGTGCACATACCATTGGAGTTGCTCATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGA
GACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACTCGGCCAACCCGGCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGC
CATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCTCTCTTGACAAACCAAGGTGCAGCCAAGGTAGTGCAGCACCTCCGGTCGCCAGACGCATTCTTCTCC
GAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCCGGTGAGATTAGAAAACAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCTGGGAAAGGTCATTTGGTTTTGTCACTGACTCTTCTCTTGGTCCTAGCGTGTAATGCAGATGATGATGGTGGATTGAGGAAGAACTTCTACAAGAAGAGTTGCCCTCAAGCT
GAGAAGCTTGTGAGGGACATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGG
GGATGTGATGGATCCGTACTG
CTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCAAGAAACAAGTTGAGCAAGCTTGCCCCAACACTGTC
TCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
TTTAAGAAGCCGATTTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATTTCGTTAGCATCCAACATC
CCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTACTCTTGCACAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTGCACATACCATTGGAGTTGCT
CATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGAGACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACTCGGCCAACCCG
GCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGCCATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCTCTCTTGACAAACCAAGGT
GCAGCCAAGGTAGTGCAGCACCTCCGGTCGCCAGACGCATTCTTCTCCGAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCCGGTGAGATTAGAAAA
CAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA