Entry information : EglPrx130
Entry ID 10950
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2012-05-15 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EglPrx130
Name EglPrx130
Class Class III peroxidase    [Orthogroup: Prx067]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx130
start..stop
S start..stop
EgrPrx130 669 0 1..323 1..323
EcamPrx129-2 656 0 1..323 1..323
EcamPrx130 655 0 1..323 1..323
EgrPrx129 649 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..67 67 N° 2 183..325 143 N° 3 1147..1908 762  
join(1..67,183..325,1147..1908)


exon

Literature and cross-references EglPrx130
Protein sequence: EglPrx130
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   34688.61 (32435.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.62 (8.72) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGPFFDAVQLEANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNGPTDPIVPFDPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDASLTRGLVKDNANHPSAWARRFTAAMVRMGLIEVLTGTQGEIRKNCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1 and extra 5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCGATTTCATTTTCCCTTATGCTAGCAGTTTCAACACGTGCGTTTGAGTTG
ATATATTGTTGATTTTCTTGTCTTGGTCATAAATTTTTGTTTTCGGTTGGGTCCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATGGTGAG
AGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGA
GTAATTTTCTAACTCAAGCATTTTATGTGCAACAT
CATTACAGGTGTGTTTGGTTNNNNNNNNNNAAAACTTCTTGGGCAAATGCAAATACTGTTTGGCAAAATTTTTTGGGTACTTTGAGGAGATGCAATTTGCACCTTCNNNNNNNNNNNNNN
NNNNNNNNNNNNNATTAAGTTTGGAGATACTTTAAAATATTATGTTTCCAAAATGCAAATAGACATTTTTCGTTCCAACTTTACCCTCGCTCAACTTTCATAATTCCGGAAATGTTCTTG
AAAGCCCTAATTTTTGCCTCAGCCACCAACGAGCANGTTGGTGAGCCACTACCACTCTCAATGGTCGTGACTGAGTTCCACCAACAAATAATTTGAGATTTTTTATAAAAAAATTAGCAA
AAACCATTTACAAAGTATAATTTGTACCATACAGTATTTCTATTAAAATTGCTTTTCAACGTGTTTTTAAAATACACTTTACCGAACAGTACTTGTATTTTGAAAAATCCTTTTAACCCA
AAGGTCTATGCATTTTCCCAAAAAATATTTTTCAAAAATCGAACTAAACACACCTTTTAAGTATTCTCTTGCGATGTCTATTACATTTGCATATTGATCCACTTTTTTTGCAAAACCCAT
ACATGGGCCAGCTTTCATTTGAATAACTAATCCTAGGAACTTAGAAGTCGGGTTTGCATGATTGATGTCACAAACTCTAAATGGATATCTAAATAAATCTGTCATAGATGTTCCTATATC
TAATTAAAAATAATCATGTAAAAATGGATATTTCTATGTTGTGACGTACGGTCTTCTAGTACTCAGGGTTGCGACGGGTCCATTCTTCTCAACTCGACCAAAGGGAACACCGCGGAGAAA
GATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCCGACATTGTGGCCTTCGCCGCTCGT
GATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTCCCCGGCCCATTTTTTGATGCTGTG
CAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAATTCACGAAGCGACTCTACTCCTTC
AACTCGACTTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCGATCGTACCATTCGATCCGGTGACGCAAGTG
CTGTGGGATGCGTCATTGACAAGGGGGTTAGTGAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTTACGGCCGCGATGGTACGCATGGGTTTGATCGAGGTGCTCACTGGC
ACGCAAGGCGAAATTAGGAAGAATTGCAGGGTGATAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATG
GTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGA
GGTTGCGACGGGTCCATTCTTCTCAACTCG
ACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCC
GACATTGTGGCCTTCGCCGCTCGTGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTC
CCCGGCCCATTTTTTGATGCTGTGCAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAA
TTCACGAAGCGACTCTACTCCTTCAACTCGACTTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCGATCGTA
CCATTCGATCCGGTGACGCAAGTGCTGTGGGATGCGTCATTGACAAGGGGGTTAGTGAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTTACGGCCGCGATGGTACGCATG
GGTTTGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGAATTGCAGGGTGATAAATTAA

Retrieve as FASTA