Entry information : EglPrx133
Entry ID 10953
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2016-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-17 (Achraf Jemmat)
Peroxidase information: EglPrx133
Name EglPrx133
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx133
start..stop
S start..stop
EgrPrx133 681 0 1..327 1..327
EcamPrx133 673 0 1..327 1..327
EguPrx133 665 0 1..327 1..327
RcPrx53 511 0 10..327 2..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..252 252 N° 2 409..597 189 N° 3 700..861 162 N° 4 1147..1527 381
join(1..252,409..597,700..861,1147..1527)


exon

Literature and cross-references EglPrx133
Protein sequence: EglPrx133
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35646.3 Transmb domain:   %s   i12-34o
PI (pH):   %s   5.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARMTNRAAADVMWGVMLLMQMMGLIRSFNFGIGGVDGLRMDYYFMSCPFAEQIVWNSVTSALQSDPTLAAGLLRMHFHDCFIQGCDGSVLLDSTKDNTAEKDSPANLSLRGYEVIDDAKEQIEEQCPGVVSCADILAMAARDAVFWAGGPRYEIPKGRKDGARSRIEDTINLPSPTFNASELIRMFGQHGFSAQEMVALSGGHTLGVARCSSFKQRLSNSDPTLDSSFAKTLSKTCSAGDNAEQPFDATRNTFDGAYYYGLVNKVGVLTSDQTLFASARTKGIVNGYAMNQAMFFFDFQQAMLKMSLLDVKEGSAGQVRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGATGACGAATAGAGCTGCGGCGGACGTGATGTGGGGGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCCGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GTATTCCACTCCAACCCTCGAGTTACCGCATGTATGCGTACACACACATAGTTTAACTATACACAAAACGAGCTCATCACGTGGATCGATATATGTGGGCAATGACTT
TCTGTGCTGCTTGTTGAGCCTGAACATGGACTTTATGCGCGTGTACAGGGATGCGATGGGTCGGTGTTGCTAGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACTTA
AGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAGGAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GTA
ATATTTTCAGCCTACATCCGTCATGAGCGCAAGCCTCAGTCACCCCCCTCCTCTCCCTCTCCTCTTTCAACTCCCCTGACGTAACCATATGAATTACAGGCGGGAGGTCCAAGATACGAA
ATACCGAAAGGGAGGAAGGACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTCCCGTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGACAGCACGGATTCTCCGCC
CAAGAGATGGTCGCTCTGTCC
GTATTCAAGGAATATGTTTACATGGTCTAATGTAACAAGAAACCTTCACATCAATCCAAATCAATCCTCGCATGCAAAAAGCTATTCAATGAAAACTTC
ACGCACTGAGTCGTAAATCATCTCTCGAGCATCCAATGCTATCTACAGGAGTGACCGACACTCTAGAACATAGATGGCATGAATTTATCAAAGGCACTGCTCCCATAAATCATGCAAAAA
CATGTACAAGCAAATCATGGAGCGGATCGTGTCTTTCGCTAATTTGTAATCAATTGAGTCCGATAGGGTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGC
AACTCCGACCCGACCCTCGACTCCAGCTTCGCCAAGACGCTGTCCAAGACGTGCAGCGCCGGGGACAACGCAGAGCAGCCCTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTAC
TACGGCCTCGTCAACAAGGTGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCCGGACCAAAGGGATTGTGAACGGGTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTC
CAGCAGGCCATGCTCAAGATGAGCCTGCTCGACGTCAAGGAAGGCTCCGCCGGCCAGGTCCGTCTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGATGACGAATAGAGCTGCGGCGGACGTGATGTGGGGGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCCGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GGATGCGATGGGTCGGTGTTGCTAGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACTTAAGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAG
GAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GCGGGAGGTCCAAGATACGAAATACCGAAAGGGAGGAAG
GACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTCCCGTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGACAGCACGGATTCTCCGCCCAAGAGATGGTCGCTCTG
TCC
GGTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGACTCCAGCTTCGCCAAGACGCTGTCCAAGACGTGCAGCGCCGGG
GACAACGCAGAGCAGCCCTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGTGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCCGG
ACCAAAGGGATTGTGAACGGGTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGACGTCAAGGAAGGCTCCGCCGGCCAGGTCCGT
CTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA