Entry information : EglPrx137 ( Px1)
Entry ID 10957
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EglPrx137 ( Px1)
Name (synonym) EglPrx137 ( Px1)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx137
start..stop
S start..stop
EgrPrx137 684 0 5..336 1..332
EguPrx137 678 0 5..336 1..332
EcamPrx137 672 0 5..336 1..331
CclPrx35 570 0 5..335 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..240 240 N° 2 556..747 192 N° 3 906..1071 166 N° 4 1167..1579 413
join(1..240,556..747,906..1071,1167..1579)


exon

Literature and cross-references EglPrx137 ( Px1)
Literature Vatulescu,A.D., Vieira-da-Silva,S.M. and Jackson,P.A. Genes encoding cell wall-modifying enzymes in Eucalyptus xylem formation. Submitted (24-JAN-2006) Plant Cell Wall Group, Instituto de Tecnologia Quimica e Tecnologica, Av. da Republica, Oeiras 2781-901, Portugal.
Protein ref. UniProtKB:   Q27U89
mRNA ref. GenBank:   DQ376124.1
Protein sequence: EglPrx137 ( Px1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   36600.84 (33724.3) Transmb domain:   %s   i12-34o
PI (pH):   %s   9.67 (9.53) Peptide Signal:   %s   cut: 27 range:27-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRARMSQSKNFLIIFCVLALAPLGLCAKAGYGGYLYPQFYDHSCPKAQEIVKSVVAKAVAKDPRMGASLLRLHFHDCFVKGCDASLLLDSSGTIISEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCADLLALAARDSTVLTGGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPIKFDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPLTGSKGQIRKRCRQVNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGCAAGAATGAGTCAATCCAAGAACTTCCTCATCATTTTCTGTGTTCTTGCTCTGGCTCCACTCGGTCTCTGTGCCAAGGCAGGTTATGGGGGTTACCTTTATCCACAATTCTAC
GACCATTCTTGCCCCAAGGCTCAAGAGATAGTGAAGTCCGTGGTGGCCAAGGCCGTTGCGAAAGATCCTCGCATGGGCGCTTCACTTCTCCGCTTACATTTCCACGATTGCTTCGTTAAG
GTCAGCGGCTACGCAATTACTTGGAGTAAATAAGTTTCCACGTCTAATCTTTGGTTTCAAAAAGTTGCAAAAATAGTTTCTTATACATGTACTCTAAGTCAGCACTCCATGCGAAGAGTA
AACAATCTCGTCGATCATTTTTCCTGGTTTAGAAGCTTTCTCGATGCTTCCAGTGCATTAACTGCTCGTCATAGCACAACAAAGCATTTCTTATCGCCACTGTCAGGAGTAATTTGTACT
TACATTATGCTTCCTACTAGAACATGTTTATAATATGCTCTGTCTAAGTACCAACGTTGTCGATGTATGTGACAGGGCTGCGACGCATCCTTATTGCTGGACAGCAGCGGCACTATAATC
AGTGAGAAGCGGTCCGTCCCTAACACGAACTCAGCCAGAGGCTTTGAAGTGCTTGATGAGATCAAATCTGCACTGGAGAAGGAGTGCCCTCAAACAGTGTCTTGTGCTGACCTGTTGGCC
TTGGCTGCCAGAGACTCCACTGTTCTT
GTAAGCATATGTAGATACAGTAGTGCCCAACTTCTCTCAGCAAGAATTTCAACTTTTCACCCAAGAAAAAACCAGGAAAAAAGAAAAGCAAAA
TAANAATAATAATAATAATTTGAAATGCCTAACGAGCATAAATCAATGCTTGAATGTGTAAACAGACTGGTGGGCCTAGCTGGGTAGTGCCACTGGGAAGGAGGGACTCAACAGGAGCAA
GCTTGAGTGGCTCTAACAACAACATTCCTGCTCCAAACAACACTTTCCAGACCATTCTCACCAAGTTCAAGCTTAAAGGACTTGATATTGTTGATCTTGTCGCCCTCTCCG
GTAAAATAA
TTGGAATTTCTTGACCTTAGTTTTGATTATAGCATTCGAGTCCAAGTTAGGGAAAATAAAATTGTTGGAAATGTCCCGTTACACAGGAAGCCACACAATTGGAAATGCAAGATGCACCAC
CTTCAGGCAGAGGCTCTACAACCAGACAGGCAACGGGCAGCCCGACTTCACGCTCGACCAATCCTACGCCGCTCAGCTCCGCACCCGCTGCCCACGGTCCGGGGGCGACCAGAACCTCTT
CTTCTTGGACTTTGTCAGCCCGATAAAGTTCGACAACAGCTACTTCAAGAACCTGCTGGCTAAGAAGGGGCTCTTGAGCTCCGACGAAGTCCTCGTGACGCAGAGCCAGGCCACGCTGCA
GCTGGTGAAGCAGTATGCGGGGAACCAAGAGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCACCCCACTGACAGGGTCCAAGGGACAGATCAGGAAGCGTTG
TAGGCAGGTCAATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGCAAGAATGAGTCAATCCAAGAACTTCCTCATCATTTTCTGTGTTCTTGCTCTGGCTCCACTCGGTCTCTGTGCCAAGGCAGGTTATGGGGGTTACCTTTATCCACAATTCTAC
GACCATTCTTGCCCCAAGGCTCAAGAGATAGTGAAGTCCGTGGTGGCCAAGGCCGTTGCGAAAGATCCTCGCATGGGCGCTTCACTTCTCCGCTTACATTTCCACGATTGCTTCGTTAAG
GGCTGCGACGCATCCTTATTGCTGGACAGCAGCGGCACTATAATCAGTGAGAAGCGGTCCGTCCCTAACACGAACTCAGCCAGAGGCTTTGAAGTGCTTGATGAGATCAAATCTGCACTG
GAGAAGGAGTGCCCTCAAACAGTGTCTTGTGCTGACCTGTTGGCCTTGGCTGCCAGAGACTCCACTGTTCTT
ACTGGTGGGCCTAGCTGGGTAGTGCCACTGGGAAGGAGGGACTCAACA
GGAGCAAGCTTGAGTGGCTCTAACAACAACATTCCTGCTCCAAACAACACTTTCCAGACCATTCTCACCAAGTTCAAGCTTAAAGGACTTGATATTGTTGATCTTGTCGCCCTCTCCG
GA
AGCCACACAATTGGAAATGCAAGATGCACCACCTTCAGGCAGAGGCTCTACAACCAGACAGGCAACGGGCAGCCCGACTTCACGCTCGACCAATCCTACGCCGCTCAGCTCCGCACCCGC
TGCCCACGGTCCGGGGGCGACCAGAACCTCTTCTTCTTGGACTTTGTCAGCCCGATAAAGTTCGACAACAGCTACTTCAAGAACCTGCTGGCTAAGAAGGGGCTCTTGAGCTCCGACGAA
GTCCTCGTGACGCAGAGCCAGGCCACGCTGCAGCTGGTGAAGCAGTATGCGGGGAACCAAGAGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCACCCCACTG
ACAGGGTCCAAGGGACAGATCAGGAAGCGTTGTAGGCAGGTCAATAAATAA

Retrieve as FASTA