Entry information : EglPrx138
Entry ID 10958
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EglPrx138
Name EglPrx138
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx138
start..stop
S start..stop
EgrPrx138 634 0 1..332 1..332
EglPrx178 629 0 1..332 1..332
EgrPrx178 629 0 1..332 1..332
EguPrx138 622 0 1..332 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..408 408 N° 2 595..757 163 N° 3 1179..1606 428  
join(1..408,595..757,1179..1606)


exon

Literature and cross-references EglPrx138
Protein sequence: EglPrx138
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   33592.93 (30504.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.33 (8.21) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGRFFPNKAALFMMLLTVCIAPTLVHGQGTRVGFYSSSCPRAEAIIRSTVQAHFxxxxxVAPGLLRMHFHDCFVQGCDGSILIDGPNxxxxxxxxxLLRGYEVIDDAKTQLEAACAGVVSCADILALAARDSVFLTNGRSWAVPTGRRDGRVSLASDTANLPGFRDSVDVQKKKFADLGLNTLDLVALVGGHTIGTGACQLFSYRLYNFTNTTSSGADASIDPSFVSQLRSLCPQNGDGTRRVALDTxxxxRFDASFFANLRSGRGVLESDQKLWTDASTKTFVQGFLSxQGPTRLDFNTEFAKSMVKMSNIGVKTGTNGEIRKICSAINA

Retrieve as FASTA  
Remarks Complete sequence from NGS (introns 2 and 3). No EST. Some XXXX in protein due to NNNN in DNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACATGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCANNNNNNNNNNNNNTGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
GTACTTTATAATCTCGTGCTTCCATTTATTAGAGATCTCCGATATGAGTGCAAACCAATGTGGATCAATTTC
ATTCACTTCTACGCAAATCTTGGCGACGGCAACATGATTGATATCTTTTAATTGCAATGATTCTTCAAATATTTGAGATATCTTGAGTGATGTGATTCATGAAATTCAATGCAGACGAAT
GGACGAAGTTGGGCCGTGCCGACGGGACGTAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCAAATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGAC
TTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GTCAGTATTTTCAATTTGTCGCCATTTCAATTTACTATCCTGCAGTACAGAAGTTGGCAACCGAATGCGTTATACTGCAGCAT
TTCCAAACCTAATTATTTTTCTCCCGTCTGCTGAATCTAAGGACAACTCCGCCCGTCGGTAGTTGTTATATTTCTTCTTGTCCTGTTGTTAAGGACGACTGTGGCTGTCCCTAAAATCTG
ATTAATCTTCTTTCTAATTTCCTTTAAGAGCTGTAAACATGAAGTTTATTTGTAAACATGAAGTTTATTTGTCATAGGTAAGATAGAATAGACATATTAAAAACTTGTCGACTTATTGCT
TCTTGCTATCTCGTAATTAAATCGAGTCTTCCCATATGTCCATGCGCATCAAAAGGGATACACTGAGTTTCTTCGCTTTTGACCAATACGCGATACAGGAGGGCACACCATAGGAACTGG
AGCTTGCCAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGG
TGATGGCACGAGGCGTGTTGCCCTCGACACCGNNNNNNNNNGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCTGATCAGAAGCTATGGACGGA
TGCCTCCACCAAAACCTTCGTGCAGGGCTTTCTAAGCNNNCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGG
GACCAATGGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACATGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCANNNNNNNNNNNNNTGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
ACGAATGGACGAAGTTGGGCCGTGCCGACGGGACGTAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCA
AATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGACTTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GAGGGCACACCATAGGAACTGGAGCTTGC
CAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGC
ACGAGGCGTGTTGCCCTCGACACCGNNNNNNNNNGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCTGATCAGAAGCTATGGACGGATGCCTCC
ACCAAAACCTTCGTGCAGGGCTTTCTAAGCNNNCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGGGACCAAT
GGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA