Entry information : EglPrx[P]143
Entry ID 10962
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx[P]143
Name EglPrx[P]143
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]143
start..stop
S start..stop
EgrPrx[P]143 114 4e-35 1..68 39..126
EguPrx[P]143 87 2e-24 1..62 39..120
EcamPrx144 88 3e-23 1..63 83..165
EgrPrx144 87 5e-23 1..62 102..183
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..132 132 N° 2 317..391 75  
join(1..132,317..391)


exon

Literature and cross-references EglPrx[P]143
Protein sequence: EglPrx[P]143
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   68
PWM (Da):   %s   6879.49  
PI (pH):   %s   4.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GSVRGYEVIDYAKSEVEKICPGVVSCADIVxxxxRDAFVAVSLPSDLPSFREGLEKLVPKFASDEFFM

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short PS due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCTCTGTGAGAGGTTACGAGGTGATAGACTATGCAAAGTCGGAAGTAGAGAAGATCTGTCCAGGAGTCGTGTCTTGTGCGGATATTGTTGNNNNNNNNNNNCGAGATGCTTTTGTTGCC
GTAAGTCTTCCC
ATAATTCTGAAGATATGCATCTTATGACCACTTTATTACTTTCGAATATCGACTACAAGTTTAAATCGTTTTCCTTACCAATATAATTGATGATGTTTTGACGAAAAT
GTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGTGATCTTCCGTCGTTTCGAGAAGGCCTCGAGAAACTCGTGCC
TAAATTTGCAAGTGATGAGTTTTTTATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCTCTGTGAGAGGTTACGAGGTGATAGACTATGCAAAGTCGGAAGTAGAGAAGATCTGTCCAGGAGTCGTGTCTTGTGCGGATATTGTTGNNNNNNNNNNNCGAGATGCTTTTGTTGCC
GTAAGTCTTCCC
AGTGATCTTCCGTCGTTTCGAGAAGGCCTCGAGAAACTCGTGCCTAAATTTGCAAGTGATGAGTTTTTTATGTGA

Retrieve as FASTA