Entry information : EglPrx146
Entry ID 10965
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EglPrx146
Name EglPrx146
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx146
start..stop
S start..stop
EgrPrx146 596 0 1..319 1..323
EcamPrx146 594 0 1..319 1..323
EguPrx146 585 0 1..319 1..323
EguPrx62 420 2e-148 1..316 4..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 338..500 163 N° 3 614..773 160 N° 4 864..1281 418
join(1..219,338..500,614..773,864..1281)


exon

Literature and cross-references EglPrx146
Protein sequence: EglPrx146
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   33315.56 (30991.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.33 (9.30) Peptide Signal:   %s   cut: 25 range:25-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTGSRLALALALVLSTIAPPCSAALRAGFYKGKCGLVDVESVVATIVASRVSKDPSIVAALLRLQFHDCFVNGCDASILLDGSSSEKTAGPNLSVRGYxDLIDAAKAVVEAICADIIVMATRDAVALAKGGRYSVQTGRLDGKISLAQNVNLPGPSMTVSQAALAFARKGFTISDMVILLGGHTVGITHCSLFQDRLYNFNGLGKPDPTMDPKLVAALRPRCPQTATIDNTVNLDQNSSSALVVDNSFYKQIVARRGILQIDQELAVDRLSKSLxVATLANATNFSARFGLAMVKLGALQSRLPGEIRSSCRAINKRS

Retrieve as FASTA  
Remarks Complete sequence from NGS. Short PS is missing due to NNNN which is completed by PCR and sequencing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACGGGAAGTAGATTGGCGTTGGCCCTCGCTCTCGTCCTCTCGACCATCGCGCCCCCATGCTCCGCCGCTCTCCGGGCAGGGTTCTACAAAGGCAAGTGTGGCCTTGTGGATGTC
GAGTCCGTGGTCGCGACCATCGTGGCCTCCCGGGTCTCCAAGGACCCGTCCATTGTGGCCGCGCTGCTCCGCTTGCAGTTCCACGATTGCTTCGTCAAT
CTAAAGCCGTCGTGATGACCG
ATCGATGCTAATGTTGCGTCCTTTTTTCCCCTTGAAGGGCTGTGACGCGTCGATCCTGCTAGACGGGAGCTCGAGCGAGAAAACGGCGGGGCCGAATTTGAGCGTGAGGGGCTACGNNGA
TCTTATCGACGCAGCCAAGGCGGTGGTCGAGGCCATCTGCGCTGACATCATCGTCATGGCAACTCGGGACGCTGTCGCTTTGGTAATGGAAAGAAAAATTACTTCAAACCCCATCGTACC
CGATTCGAATTCGGTCGTGT
CATGTTCGGATTAGCCCTAATGCTATCTCGAAAACTCATTTTCGTTCAATTTCAGGCCAAAGGAGGAAGGTACAGTGTGCAAACGGGGAGGCTGGATGGC
AAGATATCGCTGGCCCAAAATGTGAATCTCCCAGGTCCTTCCATGACAGTTTCTCAGGCTGCTTTGGCCTTTGCTCGAAAGGGATTCACCATCTCCGACATGGTCATTCTTCTAGGTACC
GACGGTGTATGCTATAATTATACTAATCGCTTTTGGTAGACGGCTTCGGACTT
AACTTATATACGCATCATTCGGACTTCGTCAGGTGGCCACACTGTCGGGATTACGCACTGCTCCCTC
TTCCAAGACCGGCTCTACAACTTCAACGGATTGGGGAAGCCCGACCCGACCATGGATCCTAAGCTCGTGGCTGCCCTCCGGCCGAGGTGCCCGCAGACCGCGACCATCGATAACACCGTG
AACCTGGACCAGAATTCTTCGAGCGCGCTCGTCGTCGACAATTCCTTCTACAAGCAAATAGTTGCCCGGAGAGGGATTCTGCAGATCGACCAAGAGCTAGCGGTCGATAGGCTGAGCAAG
TCCCTGTGNGTGGCAACACTGGCCAATGCCACCAACTTCTCCGCTCGGTTCGGCCTCGCCATGGTCAAGCTGGGTGCTCTCCAGAGCCGCTTGCCCGGCGAAATTAGGAGTTCTTGCCGA
GCCATAAACAAAAGGAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACGGGAAGTAGATTGGCGTTGGCCCTCGCTCTCGTCCTCTCGACCATCGCGCCCCCATGCTCCGCCGCTCTCCGGGCAGGGTTCTACAAAGGCAAGTGTGGCCTTGTGGATGTC
GAGTCCGTGGTCGCGACCATCGTGGCCTCCCGGGTCTCCAAGGACCCGTCCATTGTGGCCGCGCTGCTCCGCTTGCAGTTCCACGATTGCTTCGTCAAT
TTGAGCGTGAGGGGCTACGNN
GATCTTATCGACGCAGCCAAGGCGGTGGTCGAGGCCATCTGCGCTGACATCATCGTCATGGCAACTCGGGACGCTGTCGCTTTGGTAATGGAAAGAAAAATTACTTCAAACCCCATCGTA
CCCGATTCGAATTCGGTCGTGT
CCCAAAATGTGAATCTCCCAGGTCCTTCCATGACAGTTTCTCAGGCTGCTTTGGCCTTTGCTCGAAAGGGATTCACCATCTCCGACATGGTCATTCTT
CTAGGTACCGACGGTGTATGCTATAATTATACTAATCGCTTTTGGTAGACGGCTTCGGACTT
CAACGGATTGGGGAAGCCCGACCCGACCATGGATCCTAAGCTCGTGGCTGCCCTCCGG
CCGAGGTGCCCGCAGACCGCGACCATCGATAACACCGTGAACCTGGACCAGAATTCTTCGAGCGCGCTCGTCGTCGACAATTCCTTCTACAAGCAAATAGTTGCCCGGAGAGGGATTCTG
CAGATCGACCAAGAGCTAGCGGTCGATAGGCTGAGCAAGTCCCTGTGNGTGGCAACACTGGCCAATGCCACCAACTTCTCCGCTCGGTTCGGCCTCGCCATGGTCAAGCTGGGTGCTCTC
CAGAGCCGCTTGCCCGGCGAAATTAGGAGTTCTTGCCGAGCCATAAACAAAAGGAGTTGA

Retrieve as FASTA