Entry information : EglPrx[P]147
Entry ID 10966
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EglPrx[P]147
Name EglPrx[P]147
Class Class III peroxidase     [Orthogroup: Prx161]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]147
start..stop
S start..stop
EgrPrx[P]147 612 0 13..323 2..312
EguPrx[P]147 591 0 13..323 2..312
EglPrx148 572 0 1..323 1..322
EguPrx148 570 0 2..323 2..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..220 220 N° 2 296..487 192 N° 3 581..739 159 N° 4 884..1281 398
join(1..220,296..487,581..739,884..1281)


exon

Literature and cross-references EglPrx[P]147
Protein sequence: EglPrx[P]147
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (295)
PWM (Da):   %s   33781.78 (31166.6)  
PI (pH):   %s   7.53 (7.92) Peptide Signal:   %s   cut: 28 range:28-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSSCSVALFxTLSCTLLLLMGCSDAQLSPDFYSKTCPNVFTAVKSRVESTVKKEPRMGASLLCLFFHDCFVNGCDGWVLLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSVVEKVCPGVVSCADLLAITARDSIVLLGGPSWNVKLGRRDARTASQAATNxxxxxxx*NLTDLISSFENSGLSTTNLVALTGSHSIGQAKCANFRARIYNETDLDRSFGEIRRKNCPSSASPRDNNLAPLDLQSPVAFDNTYYTNLLQFKGLLHSNQQLFNGGSTDSLVRTYASSPSTFSFDFAAAMIKMGDILPLTGSDGEVRKNCRKIN

Retrieve as FASTA  
Remarks Pseudogene from NGS. PS is missing due to NNNN. Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTTCGTCATGTTCTGTGGCCCTTTTTCNNACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTTTCCCCCGATTTCTATTCAAAAACATGTCCGAAC
GTCTTCACCGCGGTCAAATCCCGGGTGGAATCCACTGTCAAGAAGGAACCTAGAATGGGAGCCTCCCTCCTCTGCCTGTTTTTCCATGATTGCTTTGTGA
ATGTAAGCTACCATAAATTG
ACTTATCTTTCTTTCATTGTATCCTAGAAATTCATTTTGTTTTTCGTCTATTGCCAGGGCTGTGATGGATGGGTTCTTCTCGACGACACGCCAACTTTCACTGGTGAAAAGAACGCAGCT
CCAAACCGAAACTCTGCCAGAGGATTCGAGGTCATAGACGATGTCAAGTCTGTTGTGGAGAAAGTGTGCCCTGGTGTTGTTTCTTGCGCTGACTTGTTGGCCATCACCGCTCGCGACTCC
ATCGTCT
TGGTAAGCCCTCCCAATCCCTCCAAAAAAAATCACTACCCCATACAAGTACTACTCACAAATTTGCTCTAACTAAGATTGTGTTGAAATTTGCAGCTTGGAGGGCCAAGCTGG
AACGTGAAACTCGGAAGGAGAGATGCAAGAACCGCGAGCCAAGCAGCTACTAACNNNNNNNNNNNNNNNNNNNCCTGAAACCTTACCGACCTCATATCTAGCTTTGAAAATTCTGGCCTC
TCCACGACAAACTTGGTGG
CTTTATCTGGTACGTACACTCATAAACACAATCCCGAACGGTTGCTGGANNNNNNNNNCAAAAAACATTTTTTTTTAATTTTTTTTATTGTAAATGGAGAA
AAAAAGAAAAAGAAAAAAAAGAGATACTAACTTATCATATTTGTTTTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGCAAATTTCAGAGCTCGGATCTACAATGAGACCGACCTG
GACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTAGCCCGAGGGACAACAATCTAGCCCCACTCGACCTGCAGTCTCCCGTTGCATTTGACAACACTTACTACACC
AACCTTCTCCAGTTCAAAGGACTGCTTCACTCCAACCAGCAGCTCTTCAATGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGTAGCCCGAGCACCTTCAGCTTCGACTTCGCA
GCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGTGAAGTCAGGAAGAACTGTAGGAAGATCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTTCGTCATGTTCTGTGGCCCTTTTTCNNACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTTTCCCCCGATTTCTATTCAAAAACATGTCCGAAC
GTCTTCACCGCGGTCAAATCCCGGGTGGAATCCACTGTCAAGAAGGAACCTAGAATGGGAGCCTCCCTCCTCTGCCTGTTTTTCCATGATTGCTTTGTGA
AGGGCTGTGATGGATGGGTT
CTTCTCGACGACACGCCAACTTTCACTGGTGAAAAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTCGAGGTCATAGACGATGTCAAGTCTGTTGTGGAGAAAGTGTGCCCTGGT
GTTGTTTCTTGCGCTGACTTGTTGGCCATCACCGCTCGCGACTCCATCGTCT
AGCTTGGAGGGCCAAGCTGGAACGTGAAACTCGGAAGGAGAGATGCAAGAACCGCGAGCCAAGCAGCT
ACTAACNNNNNNNNNNNNNNNNNNNCCTGAAACCTTACCGACCTCATATCTAGCTTTGAAAATTCTGGCCTCTCCACGACAAACTTGGTGG
TTTTGACAGGTTCACATTCGATAGGGCAA
GCGAAATGTGCAAATTTCAGAGCTCGGATCTACAATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTAGCCCGAGGGACAACAATCTAGCC
CCACTCGACCTGCAGTCTCCCGTTGCATTTGACAACACTTACTACACCAACCTTCTCCAGTTCAAAGGACTGCTTCACTCCAACCAGCAGCTCTTCAATGGCGGCTCCACGGACTCACTG
GTGAGGACATATGCCAGTAGCCCGAGCACCTTCAGCTTCGACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGTGAAGTCAGGAAGAACTGTAGG
AAGATCAAT

Retrieve as FASTA