Entry information : EglPrx150
Entry ID 10969
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2016-03-23 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-03-23 (Achraf Jemmat)
Peroxidase information: EglPrx150
Name EglPrx150
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx150
start..stop
S start..stop
EgrPrx150 499 0 1..298 1..298
EguPrx150 495 4e-179 1..298 1..298
EguPrx152 480 2e-173 1..298 1..298
EcamPrx150 477 1e-171 1..298 16..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..162 162 N° 2 305..1039 735  
join(1..162,305..1039)


exon

Literature and cross-references EglPrx150
Protein sequence: EglPrx150
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   298
PWM (Da):   %s   26358.02  
PI (pH):   %s   7.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLNSGSATLQVGFYRSTCPAAESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGNPSEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINYAVPAGxxxxxxxxxxxxxxNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSFxxxxxxxxxxxxxxxxxxxxxxSELKAKCPNNGGTSDPTVPLDFVTPNGLDNKYYTxxxxxxxxxxxxQTLFNSPSTAHIVRRNANHGGAWANKFAAAMVKMGSIDVLTGSQ

Retrieve as FASTA  
Remarks Partial sequence from NGS. PS and some part are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGAACTCAGGTTCAGCAACTCTCCAAGTCGGATTCTACCGCTCCACTTGCCCGGCTGCGGAGTCTGTCGTTCGAAAAGCCGTGAACAAGGCGGTGGCCAGAAATCCCGGCATTGGT
GCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GTATGCAAACACTTCTTACAACATTTCTGAAGTAGCAGTAACAATCTCGATTTCAATAAGCAGTAACTTAATAATCGA
CGTTCCTTATGCAGATGCATTTCAGCAATTCTGATGATTTTCGTATTTTTTGAAACAATAATAGGGTTGCGATGCATCAATTTTGCTCGATTCAACACCGGGCAACCCATCAGAGAAGGA
GCATCCCGCGAACAACCCAAGCTTACGAGGCTACGAAGTCATCGACGAGGCAAAGGCCGAGCTAGAGTATCTATGCCCCCAGACGGTCTCCTGTGCCGATATTCTGGCATTCGCAGCCCG
CGACAGCACCTACAAGCTGGGCAGCATTAACTACGCAGTCCCGGCCGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAGAATCTTCCCCCTCCTTCCTTGGATGCTCA
ACAGTTAGAAGCTAATTTTGCTAGGAAAGGTCTCTCCCTAGACGAAATGGTGACACTATCCGGTGCGCATTCGATCGGAGTCTCGCACTGTTCCTCCTTCNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGGAACTGAAAGCGAAGTGTCCGAACAATGGTGGTACCAGCGACCCGACGGTCCCATTGGACTTTGTCACTCC
CAACGGGCTCGACAACAAGTACTACACTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAAACGCTTTTTAATAGCCCTTCGACGGCACATATTGTGAGGAGGAACGCTAATCA
TGGCGGAGCATGGGCTAACAAATTTGCAGCTGCAATGGTGAAGATGGGATCAATCGATGTTCTCACCGGGAGCCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGAACTCAGGTTCAGCAACTCTCCAAGTCGGATTCTACCGCTCCACTTGCCCGGCTGCGGAGTCTGTCGTTCGAAAAGCCGTGAACAAGGCGGTGGCCAGAAATCCCGGCATTGGT
GCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GGTTGCGATGCATCAATTTTGCTCGATTCAACACCGGGCAACCCATCAGAGAAGGAGCATCCCGCGAACAACCCAAGC
TTACGAGGCTACGAAGTCATCGACGAGGCAAAGGCCGAGCTAGAGTATCTATGCCCCCAGACGGTCTCCTGTGCCGATATTCTGGCATTCGCAGCCCGCGACAGCACCTACAAGCTGGGC
AGCATTAACTACGCAGTCCCGGCCGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAGAATCTTCCCCCTCCTTCCTTGGATGCTCAACAGTTAGAAGCTAATTTTGCT
AGGAAAGGTCTCTCCCTAGACGAAATGGTGACACTATCCGGTGCGCATTCGATCGGAGTCTCGCACTGTTCCTCCTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNTCGGAACTGAAAGCGAAGTGTCCGAACAATGGTGGTACCAGCGACCCGACGGTCCCATTGGACTTTGTCACTCCCAACGGGCTCGACAACAAGTAC
TACACTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAAACGCTTTTTAATAGCCCTTCGACGGCACATATTGTGAGGAGGAACGCTAATCATGGCGGAGCATGGGCTAACAAA
TTTGCAGCTGCAATGGTGAAGATGGGATCAATCGATGTTCTCACCGGGAGCCAGTAG

Retrieve as FASTA