Entry information : EglPrx154
Entry ID 10973
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EglPrx154
Name EglPrx154
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx154
start..stop
S start..stop
EgrPrx154 647 0 1..315 1..315
EgrPrx153 643 0 1..315 1..315
EguPrx153 642 0 1..315 1..315
EglPrx153 639 0 1..315 1..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..180 180 N° 2 416..1183 768  
join(1..180,416..1183)


exon

Literature and cross-references EglPrx154
Protein sequence: EglPrx154
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315
PWM (Da):   %s   33566.68  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSFITFLNSGSATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAVPAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSFSDRLYSFNATHTQDPSMDTKxxSQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGSEGEIRRKCRVVN

Retrieve as FASTA  
Remarks Complete sequence from NGS. Two XX in frame due to NNN in DNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCGTTCATCACCTTTCTGAACTCGGGTTCAGCAACTCTCCAAGTGGGATTCTACCGCTCCACTTGTCCGTCTGCGGAGTCCGTCGTCCGGAAAGCAGTGAACAAAGCGGTGGCC
AAGAACCCTGGCATCGGTGCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GTATGCAAGAACTTCTTTACACATTTCAGAAGTAGTGGTTATAATCTCGTTTGCGGAAAA
GTACAAAAGATATCGATGAGATGGGAGTGTGGGGAGTACATTTCACATTCTATCACTGGTCCAGGACTTTTTAAGTTTTGTCTAACCGACCGGTCACAAAATAATCTATATTTCTTNNNN
NNNNNNNNNNNNNNNNNNNNNNTAATTAATTGGCTGATCTTTGATCCAATAATAGGGTTGCGATGCTTCAATCTTGCTGGATTCGACCCCAGGCAACCCATCAGAGAAGGAACATCCCGC
AAACAACCCGAGCTTGCGAGGTTTTGAAGTCATCGATGAGGCGAAGGCTGAGCTAGAGTCTCTATGCCCGCAGAAGGTCTCATGCGCTGACATTCTTGCATTCGCAGCACGCGACAGTGC
CTACAAACTCGGCAGCATCAACTACGCAGTCCCAGCGGGTCGCCGCGATGGGCTGGTCTCACTCAAAGACGAGCCCTCCCAGAATCTTCCTCCTTTCTTCTTCAATGCGCAACAATTAGA
AGCTAATTTTGCGAGCAAAGGCCTCTCTCTGGACGAGATGGTGACGCTATCCGGTGCACATTCGATTGGAGTCTCGCATTGCTCCTCCTTCTCGGACCGCTTGTACTCCTTCAATGCCAC
TCACACCCAAGACCCTTCAATGGACACCAAGTTNNNTAGTCAACTGAAATCTAAGTGTCCGAACAATGGAGGCGCTAGCGATCCCACTGTGCCATTGGACTTGGTCACGCCGAACAGGCT
AGACAACAAGTACTACACTAATTTGAAGAACCACCGAGGCCTATTGACTTCTGATCAGACTCTTTTTAACAGCCCTTCAACGGCTAATATCGTGAGGAGCAATGCAAATAATGGCGGAGC
ATGGGCTAACAAGTTCGCGGCAGCAATGGTGAAGATGGGATCGATCGACATCCTCACTGGGAGTGAGGGTGAGATTAGGAGGAAATGCAGAGTGGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCGTTCATCACCTTTCTGAACTCGGGTTCAGCAACTCTCCAAGTGGGATTCTACCGCTCCACTTGTCCGTCTGCGGAGTCCGTCGTCCGGAAAGCAGTGAACAAAGCGGTGGCC
AAGAACCCTGGCATCGGTGCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GGTTGCGATGCTTCAATCTTGCTGGATTCGACCCCAGGCAACCCATCAGAGAAGGAACAT
CCCGCAAACAACCCGAGCTTGCGAGGTTTTGAAGTCATCGATGAGGCGAAGGCTGAGCTAGAGTCTCTATGCCCGCAGAAGGTCTCATGCGCTGACATTCTTGCATTCGCAGCACGCGAC
AGTGCCTACAAACTCGGCAGCATCAACTACGCAGTCCCAGCGGGTCGCCGCGATGGGCTGGTCTCACTCAAAGACGAGCCCTCCCAGAATCTTCCTCCTTTCTTCTTCAATGCGCAACAA
TTAGAAGCTAATTTTGCGAGCAAAGGCCTCTCTCTGGACGAGATGGTGACGCTATCCGGTGCACATTCGATTGGAGTCTCGCATTGCTCCTCCTTCTCGGACCGCTTGTACTCCTTCAAT
GCCACTCACACCCAAGACCCTTCAATGGACACCAAGTTNNNTAGTCAACTGAAATCTAAGTGTCCGAACAATGGAGGCGCTAGCGATCCCACTGTGCCATTGGACTTGGTCACGCCGAAC
AGGCTAGACAACAAGTACTACACTAATTTGAAGAACCACCGAGGCCTATTGACTTCTGATCAGACTCTTTTTAACAGCCCTTCAACGGCTAATATCGTGAGGAGCAATGCAAATAATGGC
GGAGCATGGGCTAACAAGTTCGCGGCAGCAATGGTGAAGATGGGATCGATCGACATCCTCACTGGGAGTGAGGGTGAGATTAGGAGGAAATGCAGAGTGGTGAACTAG

Retrieve as FASTA