Entry information : EglPrx155
Entry ID 10974
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-04-13 (Christophe Dunand)
Peroxidase information: EglPrx155
Name EglPrx155
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx155
start..stop
S start..stop
EguPrx155 255 5e-86 51..181 200..339
EguPrx155 66 0.0000000000002 18..73 36..86
EgrPrx155 255 5e-86 51..181 200..339
EgrPrx155 66 0.0000000000003 18..73 36..86
RcPrx41 214 3e-70 51..181 188..320
RcPrx41 47 0.0000006 17..54 24..61
BnPrx31-1_other 206 1e-69 51..181 8..141
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..162 162 N° 2 556..630 75 N° 3 658..966 309  
join(1..162,556..630,658..966)


exon

Literature and cross-references EglPrx155
Protein sequence: EglPrx155
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181 (164)
PWM (Da):   %s   19066.56 (17520.7)  
PI (pH):   %s   9.85 (9.85) Peptide Signal:   %s   cut: 18 range:18-181
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PLLLAVLLASSAAPAASRLTADYYAxxxxRFHHIVQDTVTSKQISTPTTAAATLGAHTVGFSHCKEFSSGIYGFSKSSSAQGLQKACASYGKDPTLSVFNDVMTPNKFDNMYYQNLPKGxxxLASDRGLYGDPRTRPFVEMYARDQDRFFKDFARAMQKLSLYGVQTGRRGEIRRRCDAVN

Retrieve as FASTA  
Remarks Partial sequence from NGS. 5' and PS are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGCTCCTCCTCGCCGTCCTCCTCGCCTCCTCCGCCGCGCCCGCCGCCTCCCGCCTCACCGCCGACTACTACGCCNNNNNNNNNNCGCGCTTCCACCATATCGTCCAGGACACCGTCACC
TCCAAGCAGATCTCCACCCCCACCACCGCCGCCGCCACCCTN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGCGCCCACACCGTGGGGTTCTCCCACTGCAAGGAGTTCAGCTCC
GGGATCTACGGCTTCAGCAAGTCCTCCTCC
NNNNNNNNNNNNNNNNNNNNNNNNNNCGCGCAGGGGCTGCAGAAGGCCTGCGCCTCCTACGGCAAGGACCCGACGCTCTCGGTGTTCAAC
GACGTGATGACCCCCAACAAGTTCGACAACATGTACTACCAGAACCTGCCCAAGGGGCNNNNNNNGCTCGCGTCGGATCGGGGGCTGTACGGCGACCCCAGGACGAGGCCGTTCGTGGAG
ATGTACGCCAGGGATCAGGACCGGTTCTTCAAGGACTTCGCGAGGGCGATGCAGAAGCTGAGCCTCTACGGGGTCCAGACCGGGAGGAGGGGCGAGATCAGGCGAAGGTGCGATGCCGTC
AATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGCTCCTCCTCGCCGTCCTCCTCGCCTCCTCCGCCGCGCCCGCCGCCTCCCGCCTCACCGCCGACTACTACGCCNNNNNNNNNNCGCGCTTCCACCATATCGTCCAGGACACCGTCACC
TCCAAGCAGATCTCCACCCCCACCACCGCCGCCGCCACCCTN
GGCGCCCACACCGTGGGGTTCTCCCACTGCAAGGAGTTCAGCTCCGGGATCTACGGCTTCAGCAAGTCCTCCTCCGCG
CAGGGGCTGCAGAAGGCCTGCGCCTCCTACGGCAAGGACCCGACGCTCTCGGTGTTCAACGACGTGATGACCCCCAACAAGTTCGACAACATGTACTACCAGAACCTGCCCAAGGGGCNN
NNNNNGCTCGCGTCGGATCGGGGGCTGTACGGCGACCCCAGGACGAGGCCGTTCGTGGAGATGTACGCCAGGGATCAGGACCGGTTCTTCAAGGACTTCGCGAGGGCGATGCAGAAGCTG
AGCCTCTACGGGGTCCAGACCGGGAGGAGGGGCGAGATCAGGCGAAGGTGCGATGCCGTCAATTAA

Retrieve as FASTA