Entry information : EglPrx156
Entry ID 10975
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2012-05-15 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EglPrx156
Name EglPrx156
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx156
start..stop
S start..stop
EgrPrx156 667 0 1..326 1..326
EguPrx156 664 0 1..326 1..326
EcamPrx156 663 0 1..326 1..326
CclPrx43 519 0 8..325 7..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..213 213 N° 2 1340..1531 192 N° 3 1648..2223 576  
join(1..213,1340..1531,1648..2223)


exon

Literature and cross-references EglPrx156
Protein sequence: EglPrx156
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   34737.27 (32227.8) Transmb domain:   %s   i5-22o
PI (pH):   %s   4.82 (4.59) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARKLGLWLVVVFAVAATAEVGRAQLTEGFYGQTCPNVESIVKQAVTTKFGQTFVTIPGTLRLFFHDCFIEGCDASILISSPNGDAEKDAPDNQSLAGDGFDTVIKAKQAVEASCQGVVSCADILAIAARDVVVLAGGPSFNVELGRRDGLISKASLVAGKLPEPNFDLDQLNAIFSQHGLTQSDMIALSGAHTLGFSHCDRFANRLYSFSSSSPVDPTLNSTYAVQLMQECPQNVDPQIAINMDPVTPQTFDNMYYTNLVQGKGLFTSDETLFTDSASKPTVLNFANSPGSFNQAFATAMRKLGRVGIKTGSQGEIRRDCTAFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGTGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCGTCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GTGAATCCCTTTTCCTCCATGCATGCA
TTTCCGATCATGCTGCCTTCTCCTCCTTTTTCAGTTTCATCTGATTAATCACACATACATAACCCTGGCAAGTAATAGCCTTTCGATCGCAATTCCAAAAGCCCTGAATCAATTGCTAAT
TCATTCGATTAACTCTCATTTCCACAATCTTTCGGATATTCGTCCAGTCTTACACCGTAATATTTTCTTTTTCGGTATATCTTCATGAATATTTTTCTTTAAGTAAAAAGGGAATTAGAA
TGTACATGGATTATCGTTACTTCTTCCACAATGTTACCCAAGTTTTTTAGACGGTCAAAATTGCCGCTCGTTCTTTGCTTGAGCTGAGCCGGAGTTTGAACATTTGGCGAGGTTCTATCC
TAACATCGTACAAATTATATCAATTATATAGAGGAATCATAAGGAACAAGAAGTTGACTTTGGAACACATGTTTTACGTTTTCAATCATTTCATGGACAAAATGAGACGTTTTCATCTAC
CCCAATATTTTCCCGACCAAAAAAAAAAAAAAAAAGCTGCCCCAATATTTTAACGAGCTTTCTCACAGAGCCCCAACCACGCCTTTTGAATTAATTAATCGCAATTTGTCGAAATTAATT
GTGACAACAATTTAATTAAGGGAATCAAAAGCATTCCAAGTGAAATTGCCAAACAGAGATATTTTTCCAGGGGGCAGGTAAGTGCATAACTAGTTGCACAAGACAATACAAGAACAATTG
AAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATATTCAAGTTAGCACTGACCCTTAAATGGGCATC
GTCGTGTTGATTTTCCTTATCTTGGACTTAATTGTGTGATGATTCCTCGGGCTTGGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCACCGAACTTTC
TTTTCAGGGTCCGATCTTGTTCATAAAATATGTCCTGGGAGGTATGAATTAGTTCAGGATTACTTTAGATAAGAAACGCCTGACATGAATTTCCATTCAATCACGGTTTCGGCTAGTTAA
TTTCGATGTTGTTTTTAAGGGATGCGATGCTTCGATTTTGATCTCGTCGCCTAACGGGGATGCTGAGAAAGACGCTCCGGATAATCAGTCTCTAGCCGGAGATGGGTTCGACACTGTTAT
CAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCATGCGCGGACATCCTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GTAAGCAAGAACCTCCGTGGACAGTTCAC
CCTCGCAGCTCAATGTCGAGTCAAATGACTGTCATGCTCCAAGTCTTAACGTTTTCTCACTCGTTCAATGTGCATGAAAAATCTCAGGCCGGAGGTCCATCGTTCAACGTCGAGCTCGGC
CGTCGCGACGGTCTCATCTCCAAAGCATCTCTAGTAGCCGGGAAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAATGCGATTTTCTCCCAACACGGCCTCACACAATCTGACATG
ATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGCGACCGCTTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCAACCTACGCTGTG
CAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATAGCAATCAACATGGACCCCGTGACTCCACAGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTG
TTCACTTCGGACGAGACGCTCTTCACCGATTCAGCGTCCAAGCCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCAGGCCTTTGCCACCGCGATGAGGAAGCTCGGGAGG
GTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGATTGTACAGCTTTCAATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGTGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCGTCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GGATGCGATGCTTCGATTTTGATCTCG
TCGCCTAACGGGGATGCTGAGAAAGACGCTCCGGATAATCAGTCTCTAGCCGGAGATGGGTTCGACACTGTTATCAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCA
TGCGCGGACATCCTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GCCGGAGGTCCATCGTTCAACGTCGAGCTCGGCCGTCGCGACGGTCTCATCTCCAAAGCATCTCTAGTAGCCGGG
AAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAATGCGATTTTCTCCCAACACGGCCTCACACAATCTGACATGATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGC
GACCGCTTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCAACCTACGCTGTGCAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATA
GCAATCAACATGGACCCCGTGACTCCACAGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTGTTCACTTCGGACGAGACGCTCTTCACCGATTCAGCGTCCAAG
CCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCAGGCCTTTGCCACCGCGATGAGGAAGCTCGGGAGGGTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGAT
TGTACAGCTTTCAATTCATGA

Retrieve as FASTA