Entry information : EglPrx158
Entry ID 10977
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2012-05-15 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EglPrx158
Name EglPrx158
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx158
start..stop
S start..stop
EcamPrx158 644 0 1..316 1..316
EgrPrx158 644 0 1..316 1..316
EguPrx158 633 0 1..316 1..316
PpePrx30 529 0 1..316 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 305..493 189 N° 3 1013..1175 163 N° 4 1309..1703 395
join(1..204,305..493,1013..1175,1309..1703)


exon

Literature and cross-references EglPrx158
Protein sequence: EglPrx158
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   33645.07 (31425.8)  
PI (pH):   %s   9.11 (9.11) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIGVALFSSLLVLSFVSPISSLSSNYYDKTCPNAELIVANAVKNAAMKDKTVPAALLRMHFHDCFIRGCDASVLLNSKGSNKAEKDGPPNVSLHSFFVIDNAKKELEASCPGVVSCADILALAARDSVVLSGGPTWDVPKGRKDGRTSKASETTQLPAPLFNISQLQQSFSQRGLSMEDLVALSGGHTLGFSHCSSFAGRIRNFNTTHDIDPSMHPSLAASLRGVCPSKNRPKNAGTTMDPSSTTFDNTYYRLILQGKGLFSSDQALLAVPKTKGLVEKFAGSHKEFTDAFVKSMIKMSSITGGGEVRKDCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGGTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGTTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTCGCA
AATGCTGTCAAGAATGCGGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCATGACTGTTTCATTAGG
GTAAGCAAACGTGTCTGATAGTTCTCTATCTGTTTC
AGAGTTCTTACACAAAGCTTCCTTAGTTATCAGAACTCAACAGATAGTTCTCTATCTGTTTCAGGGTTGCGACGCGTCGGTGCTTTTAAACTCCAAAGGAAGCAACAAAGCGGAGAAGGA
TGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATGCCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATCTTGGCACTAGCTGCTAGAGA
TTCCGTCGTACTG
GTAAAATCTCTCCTCATCCACTTCGTTACGTGTATATCCCGATTCTTCACGACCAACCAATCCCTCCAGCATAGCTTGTCACTGAGATTGTCCTGAAAATCCACCCT
AAACCGTCTAAAACATAAACGCTGATGTCTTGGAAACATCTTAGGGCCAAGTGTAGGGATCCTGTCCAATCCTGAGCTTACTGCGCAATGTCCTGGACAGTCTTCACGCAGGTCTCTATC
CTGGAAAATAATAGAGAAACCAGGCAGGACGGTGTTAAGCTACCGACTCTTAGGAATGTCTGCTTGCACCGCAAGAATTTGGATAGATACATATTCACTCAATATGTGCATAAATAGGTT
TAAACAGGACCAAACGGAAGTCGGCCTACTGGAAGCTAAATCAATGCCCACTGAACAAATCCCTTCCCCCAGTAGTAATTTTAGCCGTAATTTCTCCACTAGAAGGTTCCCTTGTGCACA
GCATATTGCGTATCTCACTGAGATTTTCTTTCATTTCTGATGCGTAAAAAAGTCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGAC
GACTCAACTCCCAGCACCACTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
CCAGATTCATTCATTTGTTTTGGTT
TTTCACCTGTGCTGATTCTGATCTCAACTTCTATCCCTCCCCTTGCAGGAGGCCACACACTAGGATTTTCCCACTGCTCCTCCTTCGCAGGCAGGATCCGCAACTTCAACACCACGCACG
ACATCGACCCATCGATGCACCCATCCCTGGCAGCGAGCCTAAGAGGCGTGTGCCCGAGCAAGAACAGGCCAAAAAACGCAGGGACCACCATGGACCCTTCCTCGACCACCTTCGACAACA
CGTACTACAGGCTGATCCTCCAGGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGGCAGTGCCCAAGACGAAGGGTCTGGTCGAGAAGTTCGCAGGCTCGCACAAGGAATTCACGG
ATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGAAGGACTGCAGGGTAGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGGTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGTTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTCGCA
AATGCTGTCAAGAATGCGGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCATGACTGTTTCATTAGG
GGTTGCGACGCGTCGGTGCTTTTAAACTCCAAAGGA
AGCAACAAAGCGGAGAAGGATGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATGCCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATC
TTGGCACTAGCTGCTAGAGATTCCGTCGTACTG
TCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGACGACTCAACTCCCAGCACCA
CTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
ACACCACGCACGACATCGACCCATCGATGCACCCATCCCTGGCA
GCGAGCCTAAGAGGCGTGTGCCCGAGCAAGAACAGGCCAAAAAACGCAGGGACCACCATGGACCCTTCCTCGACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAGGGGAAGGGC
CTGTTCTCTTCGGACCAGGCCCTCCTGGCAGTGCCCAAGACGAAGGGTCTGGTCGAGAAGTTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGC
AGCATCACAGGCGGAGGGGAAGTTAGGAAGGACTGCAGGGTAGTCAATTAA

Retrieve as FASTA