Entry information : EglPrx[P]159
Entry ID 10978
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx[P]159
Name EglPrx[P]159
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]159
start..stop
S start..stop
EgrPrx[P]159 288 2e-100 1..172 1..240
EcamPrx[P]159 276 1e-95 2..170 1..246
EguPrx[P]159 266 7e-92 1..172 1..242
EcamPrx[P]160 228 1e-76 2..144 5..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..194 194 N° 2 307..346 40 N° 3 383..456 74 N° 4 484..824 341
join(1..194,307..346,383..456,484..824)


exon

Literature and cross-references EglPrx[P]159
Protein sequence: EglPrx[P]159
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   18132.89  
PI (pH):   %s   4.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QGCNASVLLDGSTSEPSEQDTPCGRVVSCADIATIAAHDSIFLSGRPEYDVPLGRRENLPSPTQSASQILAALAKKSFDTTTNRLYPTPDPTMEKSFARACxPDQYEDPTTRDIVTSFAKDLELFFERFVLAMTKMGQLGLLTGxxxxSPLLGQEFLEMLFPDDPKYLCPSK

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and PS are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGGATGCAATGCTTCGGTGTTGCTGGATGGATCAACGAGTGAACCGAGCGAGCAGGACACCCCATGTGGTCGGGTAGTCTCTTGTGCTGACATCGCCACCATCGCCGCTCACGATTCC
ATTTTCTTGGTAAACCCCCCTCAGCCTGTTTTGATTATAAGCTTTATGTTCTTTCAAGTTGGATTTCTTTATCG
GGGATTAATTGTAAATAATGTGAGCATGCATAATATACCGTGTGCA
GTCGGGCAGACCTGAGTATGACGTGCCATTGGGAAGGCGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGAGAATTTACCTTCACCAACTCAGAGCGCTAGCCAAATTCTCGC
TGCCCTAGCCAAGAAAAGCTTCGACACCACNNNNNNNNNNNNNNNNNNNNNNNNNNTCACCAACCGGCTCTACCCGACCCCAGACCCCACCATGGAGAAAAGCTTCGCCCGTGCATGTGC
NCCCGATCAATATGAGGACCCCACAACGAGGGACATCGTTACTAGCTTTGCCAAGGACCTGGAATTGTTCTTCGAGAGGTTTGTTCTCGCTATGACCAAGATGGGGCAGCTTGGCCTGTT
GACTGGGANNNNNNNNNNAAGCCCGCTGCTCGGTCAGGAATTCCTAGAAATGCTTTTTCCTGATGACCCCAAATATTTATGTCCTTCTAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGGATGCAATGCTTCGGTGTTGCTGGATGGATCAACGAGTGAACCGAGCGAGCAGGACACCCCATGTGGTCGGGTAGTCTCTTGTGCTGACATCGCCACCATCGCCGCTCACGATTCC
ATTTTCTTGGTAAACCCCCCTCAGCCTGTTTTGATTATAAGCTTTATGTTCTTTCAAGTTGGATTTCTTTATCG
NNNNNNNNCAGAGAATTTACCTTCACCAACTCAGAGCGCTGACACC
ACNNNNNNNNNNNNNNNNNNNNNNNNNNTCACCAACCGGCTCTACCCGACCCCAGACCCCACCATGGA
CGATCAATATGAGGACCCCACAACGAGGGACATCGTTACTAGCTTTGCCAAG
GACCTGGAATTGTTCTTCGAGAGGTTTGTTCTCGCTATGACCAAGATGGGGCAGCTTGGCCTGTTGACTGGGANNNNNNNNNNAAGCCCGCTGCTCGGTCAGGAATTCCTAGAAATGCTT
TTTCCTGATGACCCCAAATATTTATGTCCTTCTAAATAA

Retrieve as FASTA