Entry information : EglPrx[P]162
Entry ID 10981
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx[P]162
Name EglPrx[P]162
Class Class III peroxidase     [Orthogroup: Prx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]162
start..stop
S start..stop
EgrPrx[P]164 531 0 1..280 1..288
EguPrx[P]164 520 0 1..280 1..288
EgrPrx[P]162 515 0 1..280 1..286
EguPrx[P]162 508 0 1..280 1..286
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..164 164 N° 2 360..557 198 N° 3 746..908 163 N° 4 1064..1377 314
join(1..164,360..557,746..908,1064..1377)


exon

Literature and cross-references EglPrx[P]162
Protein sequence: EglPrx[P]162
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   279
PWM (Da):   %s   29799.22  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGIVLGFLGNAAVSTQAQLEMGYYSKSCPEAEKIVRxVVEDHIRNAHSLAAALLRRQGCDASVLLNSS*SNPAERDSPPNFTVRGFDFIDRVKSLVEAEFPGIVSCADIIALAARDAIAATGGPFWRVPTVRRDGVISRASEALSNIPSPSSKLNAPQTFFANKGLDLKDLVLPSGAHMIGASHCSSFRNRLYNFTGGEDQDPSLESGYAANVKAKKCRSLSNDTIFRSDSAITTSPAAKLFITQVLQGSLDNFYAQFALAMEKMGRIDVKTRLAGEIRK

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and PS are missing due to NNNN. Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCATTGTTTTGGGTTTTCTAGGGAATGCTGCTGTCTCAACTCAAGCTCAACTTGAGATGGGTTATTATTCTAAGAGCTGCCCAGAAGCTGAAAAAATTGTGAGAGANGTTGTCGAA
GATCACATCCGCAATGCTCATTCTTTAGCAGCCGCTCTGCTGAG
GATGCACTTTCANNNNNNNNNNNNNNNNNNNNTTACTTTCTCTCCCATGTAGCTTGCATCAGTGCACGTTAATACC
TTACAGTAAACTTGAGAAATTTGGAGGAATCATTACTGCATATCTCCATTTCAAGAGTACTAGTATTTTCTTAATCTCATGCTAGCTTTGAGAAATTTGAGCTCTTTGTTTGTTGATCAC
CGTCAGGGTTGTGATGCTTCTGTGCTCTTGAACTCTAGTTGAAGCAACCCAGCAGAGAGAGATTCTCCTCCAAACTTCACTGTGAGAGGCTTCGACTTCATCGATCGAGTGAAGAGCCTT
GTCGAAGCTGAATTCCCCGGGATTGTCTCTTGCGCAGACATCATAGCTTTGGCCGCAAGAGATGCAATAGCGGCCAC
TATGAGGACAACAGCACAAAGATTATTTCCACGAAAGCAGATA
TCCANNNNNNNNNNNCGTCTAGATCTTAACACTACGTGGAAACTGTTTTCTCCACTGATGATGGAATGAGGATAGATTTGCAAGCGAAAAAAGCATTGAGATTGAGTGGGGAATTAAAAC
TGTATCTGATATGCATGAAACTATAGGGAGGTCCATTTTGGAGAGTTCCTACTGTAAGAAGAGATGGAGTGATTTCAAGGGCATCGGAAGCATTGAGCAACATCCCTTCTCCATCCAGCA
AACTCAACGCTCCCCAAACATTTTTCGCCAATAAAGGACTCGATCTTAAAGACTTAGTTTTACCGTCC
GGTGAGGCCATATGTCACCCACCTATAAAAATGAGAGGATATCAGTTGATGA
GTTAAACCATTAGTATCGAGAGATAACGAAATGTATATTCAGTACATGACTAAGCTGGTCATGTGCTAAATTAGTAGTGGCTGATGTGACTTGTTCTGACATAGGAGCTCACATGATTGG
TGCATCTCACTGCTCGTCTTTCCGGAACCGCCTATACAACTTCACTGGCGGTGAGGATCAAGACCCCTCCTTGGAAAGCGGGTACGCGGCGAATGTCAAGGCCAAGAAGTGCAGGAGCCT
GAGTAACGATACCATCTTTCGATCGGATTCTGCTATCACTACCAGTCCTGCTGCCAAGCTCTTCATCACACAAGTCCTTCAAGGGTCACTTGACAACTTCTACGCTCAATTTGCCTTGGC
AATGGAGAAGATGGGCCGGATCGACGTGAAGACTAGGCTGGCGGGCGAGATAAGGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCATTGTTTTGGGTTTTCTAGGGAATGCTGCTGTCTCAACTCAAGCTCAACTTGAGATGGGTTATTATTCTAAGAGCTGCCCAGAAGCTGAAAAAATTGTGAGAGANGTTGTCGAA
GATCACATCCGCAATGCTCATTCTTTAGCAGCCGCTCTGCTGAG
CCGTCAGGGTTGTGATGCTTCTGTGCTCTTGAACTCTAGTTGAAGCAACCCAGCAGAGAGAGATTCTCCTCCAAAC
TTCACTGTGAGAGGCTTCGACTTCATCGATCGAGTGAAGAGCCTTGTCGAAGCTGAATTCCCCGGGATTGTCTCTTGCGCAGACATCATAGCTTTGGCCGCAAGAGATGCAATAGCGGCC
AC
GGGAGGTCCATTTTGGAGAGTTCCTACTGTAAGAAGAGATGGAGTGATTTCAAGGGCATCGGAAGCATTGAGCAACATCCCTTCTCCATCCAGCAAACTCAACGCTCCCCAAACATTT
TTCGCCAATAAAGGACTCGATCTTAAAGACTTAGTTTTACCGTCC
GGAGCTCACATGATTGGTGCATCTCACTGCTCGTCTTTCCGGAACCGCCTATACAACTTCACTGGCGGTGAGGAT
CAAGACCCCTCCTTGGAAAGCGGGTACGCGGCGAATGTCAAGGCCAAGAAGTGCAGGAGCCTGAGTAACGATACCATCTTTCGATCGGATTCTGCTATCACTACCAGTCCTGCTGCCAAG
CTCTTCATCACACAAGTCCTTCAAGGGTCACTTGACAACTTCTACGCTCAATTTGCCTTGGCAATGGAGAAGATGGGCCGGATCGACGTGAAGACTAGGCTGGCGGGCGAGATAAGGAA

Retrieve as FASTA