Entry information : EglPrx[P]164
Entry ID 10983
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-15 (Qiang Li)
Peroxidase information: EglPrx[P]164
Name EglPrx[P]164
Class Class III peroxidase     [Orthogroup: Prx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]164
start..stop
S start..stop
EgrPrx[P]164 466 1e-168 9..256 1..293
EguPrx[P]164 450 3e-162 9..256 1..293
EcamPrx[P]162 430 2e-154 3..254 1..295
EguPrx[P]162 418 1e-149 9..254 1..289
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..215 215 N° 2 390..581 192 N° 3 766..928 163 N° 4 1076..1404 329
join(1..215,390..581,766..928,1076..1404)


exon

Literature and cross-references EglPrx[P]164
Protein sequence: EglPrx[P]164
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256 (231)
PWM (Da):   %s   27528.12 (25024.8)  
PI (pH):   %s   9.21 (8.96) Peptide Signal:   %s   cut: 26 range:26-256
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRLFGLGMGIVLGFLGNIAVSTQAQLEMGYYSKSCPEAEKIARELSKxHIRNAHSLAAALLRMHFHDLLRRNFTVRGFDFIDRAKSLVEAEYARIVSCSDIIALAARDAIVATLSNIPSPSSKLNAPQTFFANKGLDLKDLVLSSGAHTIVASHCSSFRNxLYNFTGGEDQDPSLESGYAANLKAKKCRSLSNDTIFRSDSAITTSPATKLFITQVLQGSLDNFYAQFVMAMEKMGRIDVKTGLAGEIRKHCAGE

Retrieve as FASTA  
Remarks Pseudogene from NGS. Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGACTGTTTGGTTTGGGCATGGGCATTGTTTTGGGTTTTCTAGGGAATATTGCTGTCTCAACTCAAGCTCAACTTGAGATGGGTTATTATTCTAAGAGCTGCCCAGAAGCTGAA
AAAATTGCGAGAGAGTTGTCGAAGATNCACATCCGTAATGCTCATTCTTTAGCAGCCGCTCTGCTGAGGATGCACTTTTTGAGAAATTTGGAGAA
TCGTTACTGCATATCTCCATTTCAA
GAGTACTAGTATTTTCTTAACTTCACTGTGAGAGGCTTCGACTTCATCGATCGAGCGAAGAGCCTTGTCGAAGCTGAATATGCCAGGATTGTCTCTTGCTCAGACATCATAGCTTTGGCC
GCAAGAGATGCAATAGTGGCCACTTGCCAGCGAAACATTGAGATAGAGTGGGGAATTAAAACTGTATCTGATGTGCATGAAACTATAGTTGAGCAACATCCCTTCTCCATCCAGCAAACT
CAACGCTCCCCAAACATTTTTCGCCAATAAAGGACTCGATCTTAAAGACTTAGTTTTATCGTCCGGCGAGGCCATATGTCACCCACCTATAAAAATGAGAG
GATATCAGTTGATGAGTTA
AACCATTAGTATTGAGAGATATCGAAATGTATATTCAGTACGTTAGTCATGTGCTAAATTAGTAGTGGCTGGTGTGACTCATTCTGACATAGGAGCTCACACGATTGTTGCATCTCACTG
CTCGTCTTTCCGGAACCNCCTATACAACTTCACTGGCGGTGAGGATCAAGACCCCTCCTTGGAAAGCGGGTACGCGGCGAATCTCAAGGCCAAGAAGTGCAGGAGCCTGAGTAACGATAC
CATCTTTCGATCGGATTCTGCTATCACTACCAGTCCTGCTACCAAGCTCTTCATCACACAAGTCCTTCAAGGGTCACTTGACAACTTC
TACGCTCAATTTGTTATGGCAATGGAGAAGAT
GGGCCGGATCGACGTGAAGACTGGGCTGGCGGGCGAGATAAGGAAGCATTGTGCTGGTGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGACTGTTTGGTTTGGGCATGGGCATTGTTTTGGGTTTTCTAGGGAATATTGCTGTCTCAACTCAAGCTCAACTTGAGATGGGTTATTATTCTAAGAGCTGCCCAGAAGCTGAA
AAAATTGCGAGAGAGTTGTCGAAGATNCACATCCGTAATGCTCATTCTTTAGCAGCCGCTCTGCTGAGGATGCACTTTTTGAGAAATTTGGAGAA
GCGAAACATTGAGATAGAGTGGGGA
ATTAAAACTGTATCTGATGTGCATGAAACTATAGTTGAGCAACATCCCTTCTCCATCCAGCAAACTCAACGCTCCCCAAACATTTTTCGCCAATAAAGGACTCGATCTTAAAGACTTAGT
TTTATCGTCCGGCGAGGCCATATGTCACCCACCTATAAAAATGAGAG
TCAAGACCCCTCCTTGGAAAGCGGGTACGCGGCGAATCTCAAGGCCAAGAAGTGCAGGAGCCTGAGTAACGAT
ACCATCTTTCGATCGGATTCTGCTATCACTACCAGTCCTGCTACCAAGCTCTTCATCACACAAGTCCTTCAAGGGTCACTTGACAACTTC

Retrieve as FASTA