Entry information : EglPrx[P]165
Entry ID 10984
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EglPrx[P]165
Name EglPrx[P]165
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]165
start..stop
S start..stop
EgrPrx[P]165 396 4e-142 1..210 6..281
EglPrx126 261 3e-88 1..210 39..310
EguPrx126 261 3e-88 1..210 39..310
EgrPrx126 261 4e-88 1..210 39..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4..108 105 N° 2 194..408 215 N° 3 1473..1617 145 N° 4 1780..2139 360
join(4..108,194..408,1473..1617,1780..2139)


exon

Literature and cross-references EglPrx[P]165
Protein sequence: EglPrx[P]165
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   209
PWM (Da):   %s   22650.75  
PI (pH):   %s   9.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
EGEKIVREIAWRKSEADPTLGAKLLRLHFHNCFVQGCDGSILLDSAGKNQSGKTVVPNLTVGGFDVIDDIKKAVEEVCPDTRSRADIIALAARDAISFPVK*NLLDWKLFSAKRTEHKLAANVLGNIPLVVLSGSGAHSIGVAHCGTFSRRLYNFTGKGDTDPSLNATYAAFLQNRCNRDAAKVVQQLRMPATFFSEFGKSMKKMEAITV

Retrieve as FASTA  
Remarks Pseudogene from NGS. 5' and part of the sequence are missing due to NNNN. Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGGTGAAAAGATCGTGAGGGAGATCGCTTGGAGGAAATCTGAAGCTGACCCTACGTTGGGTGCGAAGCTTCTCAGGCTTCACTTCCACAACTGTTTTGTGCAGTATTGTGGCAATAAT
CAAATCTTCGGGTTGCGATGGGTCTATACTGTTGGACTCTGCGGGGAAGAATCAGTCCGGGAAGACCGTCGTCCCAAATCTCACGGTCGGTGGCTTTGATGTCATTGATGACATCAAGAA
AGCAGTGGAGGAAGTTTGCCCTGACACTAGGTCTCGTGCGGATATTATTGCTCTAGCCGCTCGCGATGCCATCTCTTTTCCGGTAAAATAAAATCTGCTTGATTGGTTGTCTAAAATATA
ATTTTCTTCACAAAAAATGGTCACCATATGAAGTTAAACGTGTGG
TGTAAATTGCAGTTTAAGAAGCCAATGTGAGATGTACTGACATGAAGAGATGGCAACGTTAATGCTCCGTTCGTT
TCACGGAAAATATCATGTTTCCGGAAAACATTTTCCTGGAAGTTAATATTTTCCACTGTTCGTTAGCTCAAACATTTTCCTGAAAAAAATTATCAAAAATTGAATTTTAATATTTTTAAT
TGACCAAAAAATTTATTTTATTTATTTATATTTTTTTAAATGATTTTTTTAAATTATTTATATTTTTAAAATAGAAATTTTTATTAATTTTTTTTTCCTTCCTCCTTCCTCCTCCTTCTT
CCTCCCCATTCCGCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGACGAGCTCGAGGCTCGGCCGATCTCACCCGAGCTC
GTCGGATCTGGTGACAGAGCTCGAGCTCGCCTGGATCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGATCTCACCCGAGCTCGCCGGATTTGGTGACAG
ATCTCCCCGCGAGCCTCCCGGCGCCGCCGCGGAGCTCCCTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGC
AGGCGGGCAGGAGCGGCCAGGGAGGGCGGAGGCTGGTCTCGGAGAAGGACGTCGTCGAAGCCGACTTCGCAGCAAGGAGAGCAAGAGAGAGAGAACAAGAACCGAGAAGTTATTTTCCGC
AAAACGAACGGAGCATAAGTTAGCGGCCAACGTGTTAGGGAATATTCCACTCGTCGTTCTCTCAGGTAAACTAACATGACCTTTTTTCGGATTATCGAGTTACAATTTCATGACTTATAT
TTGGATTGTTAAATTAGCATTGAAGCTAATCAAAGTACATAACTTGACATATTGCCTTGAGTTAGACATTGCACAATATACTGAAATCATCTACATCTTTGTTCCTTGATCAGGTGCACA
TTCCATTGGAGTTGCTCATTGTGGCACATTTTCTAGGAGGCTCTACAACTTCACTGGGAAAGGGGACACAGACCCCTCTCTGAACGCCACCTACGCTGCATTCCTCCAGAATCGGTGCAA
TCGAGACGCAGCTAAGGTGGTGCAGCAGCTTCGGATGCCGGCCACGTTTTTCTC
CGAGTTTGGCAAGTCGATGAAGAAGATGGAGGCAATAACCGTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGGTGAAAAGATCGTGAGGGAGATCGCTTGGAGGAAATCTGAAGCTGACCCTACGTTGGGTGCGAAGCTTCTCAGGCTTCACTTCCACAACTGTTTTGTGCAGGTCCCAAATCTCACG
GTCGGTGGCTTTGATGTCATTGATGACATCAAGAAAGCAGTGGAGGAAGTTTGCCCTGACACTAGGTCTCGTGCGGATATTATTGCTCTAGCCGCTCGCGATGCCATCTCTTTTCCGGTA
AAATAAAATCTGCTTGATTGGTTGTCTAAAATATAATTTTCTTCACAAAAAATGGTCACCATATGAAGTTAAACGTGTGG
TTTCTAGGAGGCTCTACAACTTCACTGGGAAAGGGGACAC
AGACCCCTCTCTGAACGCCACCTACGCTGCATTCCTCCAGAATCGGTGCAATCGAGACGCAGCTAAGGTGGTGCAGCAGCTTCGGATGCCGGCCACGTTTTTCTC

Retrieve as FASTA