Entry information : EglPrx[P]170
Entry ID 10989
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EglPrx[P]170
Name EglPrx[P]170
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]170
start..stop
S start..stop
EgrPrx[P]170 224 1e-77 1..108 54..161
EcamPrx[P]170 205 4e-70 1..105 54..158
EguPrx[P]170 196 8e-67 1..108 54..152
EcamPrx[P]166 114 2e-33 1..108 95..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..279 279 N° 2 313..360 48  
join(1..279,313..360)


exon

Literature and cross-references EglPrx[P]170
Protein sequence: EglPrx[P]170
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   108
PWM (Da):   %s   12312.14  
PI (pH):   %s   8.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
HAIDNARCTTIQSWLYNESNINLSFAPPPWHHEPYVLRQFRNLVNQKGLLHLDLQLFSGNSMNDQVTIYINILNLFWSDFANAMVKMGGLSPLTGSSNRIRMNCREVN

Retrieve as FASTA  
Remarks Pseudogene sequence from NGS. 5' end is missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACGCCATAGACAACGCTAGGTGCACAACGATCCAATCCTGGCTCTACAATGAGAGCAACATAAACTTGTCGTTCGCCCCACCCCCGTGGCATCATGAGCCCTACGTCCTTCGACAATTC
CGTAACTTAGTAAACCAAAAGGGCCTACTCCACTTGGATCTGCAATTGTTCAGTGGGAATTCAATGAACGATCAAGTGACCATCTACATCAACATTTTGAATTTGTTCTGGAGCGACTTT
GCTAATGCCATGGTCAAGATGGGAGGCCTTAGCCCTCTC
ACCGGGTCTAGCAATCGGATAAGAATGAATTGCAGGGAGGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACGCCATAGACAACGCTAGGTGCACAACGATCCAATCCTGGCTCTACAATGAGAGCAACATAAACTTGTCGTTCGCCCCACCCCCGTGGCATCATGAGCCCTACGTCCTTCGACAATTC
CGTAACTTAGTAAACCAAAAGGGCCTACTCCACTTGGATCTGCAATTGTTCAGTGGGAATTCAATGAACGATCAAGTGACCATCTACATCAACATTTTGAATTTGTTCTGGAGCGACTTT
GCTAATGCCATGGTCAAGATGGGAGGCCTTAGCCCTCTC
AGGGAGGTCAATTGA

Retrieve as FASTA