Entry information : EglPrx[P]174
Entry ID 10993
Creation 2012-05-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: EglPrx[P]174
Name EglPrx[P]174
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]174
start..stop
S start..stop
EgrPrx[P]174 492 6e-179 1..259 1..281
EguPrx[P]174 476 7e-173 1..259 1..281
EgrPrx154 281 2e-95 1..259 18..315
EguPrx153 281 3e-95 1..259 18..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..129 129 N° 2 274..726 453 N° 3 783..1041 259  
join(1..129,274..726,783..1041)


exon

Literature and cross-references EglPrx[P]174
Protein sequence: EglPrx[P]174
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   257
PWM (Da):   %s   27782.96  
PI (pH):   %s   7.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GFYKSTCPQVEMIVRNAVHKAVSSNPGIEAGLIRLLFHDCFVRGRDASLLLNSSPGNKAERDHPVSRSL*GFE*LMKxKSPVGSRVPKTVSCVDILAFATRESAYQLGGISYAVPAGHHDSLVFREDNMLQNLPPPSFNAKPLVDIFASKGLSERLYAVDNATDAHDPPLDANDPLVALDSTPTRLDNKYFQDLQNHRGILISDQTLYSSSAMADMVADNAHDNRACSLKFPKAMVRMGSIEVLTGSQGEVRRQCSSVN

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short 5' and fragment are missing due to NNNN. Stops in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTCTACAAATCGACATGTCCACAAGTGGAGATGATTGTGAGGAATGCTGTGCATAAGGCTGTCTCCAGCAACCCCGGCATTGAAGCCGGTCTCATTAGGTTGCTGTTCCATGATTGT
TTTGTCAGG
GTAATGTGATAGATAATCCCTTAATGTCAAGCCAAGTATATACGCGCATGTGCATGGAAAAATATTGCTTAGACTCAGTTCTATCCATGAGCGTCACGGTGCTGGAGACTG
ATAAATAGTAACCAAGTTAAACTGTGATCGCAGGGCCGTGATGCTTCTCTGCTCCTAAATTCCAGCCCAGGAAATAAGGCGGAACGAGACCATCCTGTTAGCCGCAGCTTATGAGGATTC
GAGTAATTGATGAAGCNNAAAAGCCCGGTTGGAAGCCGCGTCCCCAAAACAGTATCATGTGTGGACATCCTCGCCTTTGCCACTCGCGAAAGCGCATACCAGCTAGGAGGAATTAGCTAC
GCAGTCCCCGCTGGCCACCACGACAGCCTCGTCTTTCGCGAAGACAACATGTTACAGAACCTGCCGCCCCCTTCCTTCAATGCCAAGCCGCTGGTGGACATTTTCGCTAGCAAAGGGCTG
TCTGAACGCCTCTACGCTGTTGACAACGCAACCGATGCCCATGATCCACCATTGGATGCCAAGTACATGGCTTTCCTCGGGACCATTTGCCCGAGGCCACAGAGCAGAAACAGCGCAGCG
ATCCAC
TGGTGGCACTAGACTCAACGCCGACTCGCTTGGACAACAAGTATTTTCAGGATCTGCAGAATCACCGTGGCATATTGATTTCGGACCAGACCTTGTACTCGAGCTCTGCAATGG
CCGACATGGTCGCCGACAATGCTCACGACAATAGAGCCTGCAGTCTCAAGTTCCCAAAGGCCATGGTGCGGATGGGCTCCATTGAGGTCCTCACAGGCTCACAAGGTGAGGTTAGAAGAC
AGTGCAGCTCCGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTCTACAAATCGACATGTCCACAAGTGGAGATGATTGTGAGGAATGCTGTGCATAAGGCTGTCTCCAGCAACCCCGGCATTGAAGCCGGTCTCATTAGGTTGCTGTTCCATGATTGT
TTTGTCAGG
GGCCGTGATGCTTCTCTGCTCCTAAATTCCAGCCCAGGAAATAAGGCGGAACGAGACCATCCTGTTAGCCGCAGCTTATGAGGATTCGAGTAATTGATGAAGCNNAAAAGC
CCGGTTGGAAGCCGCGTCCCCAAAACAGTATCATGTGTGGACATCCTCGCCTTTGCCACTCGCGAAAGCGCATACCAGCTAGGAGGAATTAGCTACGCAGTCCCCGCTGGCCACCACGAC
AGCCTCGTCTTTCGCGAAGACAACATGTTACAGAACCTGCCGCCCCCTTCCTTCAATGCCAAGCCGCTGGTGGACATTTTCGCTAGCAAAGGGCTGTCTGAACGCCTCTACGCTGTTGAC
AACGCAACCGATGCCCATGATCCACCATTGGATGCCAAGTACATGGCTTTCCTCGGGACCATTTGCCCGAGGCCACAGAGCAGAAACAGCGCAGCGATCCAC
CAGAATCACCGTGGCATA
TTGATTTCGGACCAGACCTTGTACTCGAGCTCTGCAATGGCCGACATGGTCGCCGACAATGCTCACGACAATAGAGCCTGCAGTCTCAAGTTCCCAAAGGCCATGGTGCGGATGGGCTCC
ATTGAGGTCCTCACAGGCTCACAAGGTGAGGTTAGAAGACAGTGCAGCTCCGTGAAT

Retrieve as FASTA